CHX10 Antibody - BSA Free | Novus Biologicals NBP1-84476 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CHX10 Antibody - BSA Free

catalog :

NBP1-84476

quantity :

0.1 ml (also 25 ul)

price :

539 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

JB42-35

reactivity :

human, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 8

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; human; 1:200; fig 2A	Geng Z, Walsh P, Truong V, Hill C, Ebeling M, Kapphahn R, et al. Generation of retinal pigmented epithelium from iPSCs derived from the conjunctiva of donors with and without age related macular degeneration. PLoS ONE. 2017;12:e0173575 pubmed publisher
	Hahn J, Monavarfeshani A, Qiao M, Kao A, K xf6 lsch Y, Kumar A, et al. Evolution of neuronal cell classes and types in the vertebrate retina. Nature. 2023;624:415-424 pubmed publisher
	Hahn J, Monavarfeshani A, Qiao M, Kao A, K xf6 lsch Y, Kumar A, et al. Evolution of neuronal cell classes and types in the vertebrate retina. bioRxiv. 2023;: pubmed publisher
	Xu Z, Bai S, Wu H, Fang M. Elevated retinal retinol-binding protein 4 levels in diabetic mice can induce retinal neurodegeneration through microglia. Microsc Res Tech. 2023;86:223-231 pubmed publisher
	Ke Y, Fan X, Hao R, Dong L, Xue M, Tan L, et al. Human embryonic stem cell-derived extracellular vesicles alleviate retinal degeneration by upregulating Oct4 to promote retinal Müller cell retrodifferentiation via HSP90. Stem Cell Res Ther. 2021;12:21 pubmed publisher
	Ho R, Workman M, Mathkar P, Wu K, Kim K, O Rourke J, et al. Cross-Comparison of Human iPSC Motor Neuron Models of Familial and Sporadic ALS Reveals Early and Convergent Transcriptomic Disease Signatures. Cell Syst. 2021;12:159-175.e9 pubmed publisher
	Shrestha R, Wen Y, Ding D, Tsai R. Aberrant hiPSCs-Derived from Human Keratinocytes Differentiates into 3D Retinal Organoids that Acquire Mature Photoreceptors. Cells. 2019;8: pubmed publisher
	Li Y, He X, Li J, Ni F, Sun Q, Zhou Y. Proliferation and differentiation of direct co‑culture of bone marrow mesenchymal stem cells and pigmented cells from the ciliary margin. Mol Med Rep. 2017;15:3529-3534 pubmed publisher

product information

master code :

NBP1-84476

SKU :

NBP1-84476

product name :

CHX10 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The CHX10 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CHX10. This antibody reacts with human,rat. The CHX10 Antibody - BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Frozen,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.

target :

CHX10

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LGLNKEPPSSHPRAALDGLAPGHLLAARSVLSPAGVGGM
GLLGPGGLPGFYTQPTFLEVLSDPQSVHLQPLGRASGPL
DTSQTASSDSEDVSSSDRKMSKSALNQTKKRKKRRHRTI
FTSYQLEELEKAFNEAH
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Rat

gene symbol :

VSX2

accessionNumbers :

P58304

applications :

Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin

USD :

539 USD

alt names :

ceh-10 homeo domain containing homolog, ceh-10 homeo domain containing homolog (C. elegans), ceh-10 homeodomain containing homolog (C. elegans), Ceh-10 homeodomain-containing homolog, CHX10MCOPCB3, Homeobox protein CHX10, HOX10C elegans ceh-10 homeo domain-containing homolog, MCOP2, RET1, visual system homeobox 2

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage