SIX1 Antibody - BSA Free | Novus Biologicals NBP1-84264 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

SIX1 Antibody - BSA Free

catalog :

NBP1-84264

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

1B6

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 13

Reference
Wilson C, Mertens T, Shivshankar P, Bi W, Collum S, Wareing N, et al. Sine oculis homeobox homolog 1 plays a critical role in pulmonary fibrosis. JCI Insight. 2022;7: pubmed publisher
Min W, Wei X. Silencing SIX1 inhibits epithelial mesenchymal transition through regulating TGF-β/Smad2/3 signaling pathway in papillary thyroid carcinoma. Auris Nasus Larynx. 2020;: pubmed publisher
Xiang J, Yang S, Xin N, Gaertig M, Reeves R, Li S, et al. DYRK1A regulates Hap1-Dcaf7/WDR68 binding with implication for delayed growth in Down syndrome. Proc Natl Acad Sci U S A. 2017;114:E1224-E1233 pubmed publisher
Towers C, Guarnieri A, Micalizzi D, Harrell J, Gillen A, Kim J, et al. The Six1 oncoprotein downregulates p53 via concomitant regulation of RPL26 and microRNA-27a-3p. Nat Commun. 2015;6:10077 pubmed publisher
Adrados I, Larrasa Alonso J, Galarreta A, LÃ³pez Antona I, MenÃ©ndez C, Abad M, et al. The homeoprotein SIX1 controls cellular senescence through the regulation of p16INK4A and differentiation-related genes. Oncogene. 2016;35:3485-94 pubmed publisher
Nagel S, Meyer C, Kaufmann M, Drexler H, MacLeod R. Aberrant expression of homeobox gene SIX1 in Hodgkin lymphoma. Oncotarget. 2015;6:40112-26 pubmed publisher
Kahlert C, Lerbs T, Pecqueux M, Herpel E, Hoffmeister M, Jansen L, et al. Overexpression of SIX1 is an independent prognostic marker in stage I-III colorectal cancer. Int J Cancer. 2015;137:2104-13 pubmed publisher
Corradini E, Burgers P, Plank M, Heck A, Scholten A. Huntingtin-associated protein 1 (HAP1) is a cGMP-dependent kinase anchoring protein (GKAP) specific for the cGMP-dependent protein kinase IÎ² isoform. J Biol Chem. 2015;290:7887-96 pubmed publisher
Corradini E, Vallur R, Raaijmakers L, Feil S, Feil R, Heck A, et al. Alterations in the cerebellar (Phospho)proteome of a cyclic guanosine monophosphate (cGMP)-dependent protein kinase knockout mouse. Mol Cell Proteomics. 2014;13:2004-16 pubmed publisher
Tang T, Tu H, Chan E, Maximov A, Wang Z, Wellington C, et al. Huntingtin and huntingtin-associated protein 1 influence neuronal calcium signaling mediated by inositol-(1,4,5) triphosphate receptor type 1. Neuron. 2003;39:227-39 pubmed
Torre E, Coleman S, Yi H, Gutekunst C. A protocol for isolation and biochemical characterization of stigmoid bodies from rat brain. J Neurosci Methods. 2003;125:27-32 pubmed
Gutekunst C, Torre E, Sheng Z, Yi H, Coleman S, Riedel I, et al. Stigmoid bodies contain type I receptor proteins SorLA/LR11 and sortilin: new perspectives on their function. J Histochem Cytochem. 2003;51:841-52 pubmed
Chan E, Nasir J, Gutekunst C, Coleman S, Maclean A, Maas A, et al. Targeted disruption of Huntingtin-associated protein-1 (Hap1) results in postnatal death due to depressed feeding behavior. Hum Mol Genet. 2002;11:945-59 pubmed

product information

master code :

NBP1-84264

SKU :

NBP1-84264

product name :

SIX1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The SIX1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SIX1. This antibody reacts with human,mouse. The SIX1 Antibody - BSA Free has been validated for the following applications: Chromatin Immunoprecipitation,Chemotaxis,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Knockdown Validated.

target :

SIX1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

CFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQV
SNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLE
GGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGHARSSNY
SLPGLTASQPSHGLQTHQHQLQDS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

SIX1

Antibody validation :

Knockout/Knockdown

accessionNumbers :

Q15475

applications :

Chromatin Immunoprecipitation,Chemotaxis,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Knockdown Validated

USD :

559 USD

alt names :

BOS3, deafness, autosomal dominant 23, DFNA23, homeobox protein SIX1, sine oculis homeobox (Drosophila) homolog 1, Sine oculis homeobox homolog 1, sine oculis homeobox homolog 1 (Drosophila), SIX homeobox 1, TIP39

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage