product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
POU2F3 Antibody - BSA Free
catalog :
NBP1-83966
quantity :
0.1 ml (also 25 ul)
price :
569 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
RA3-6B2
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 10
Reference
Wang Z, Liu C, Zheng S, Yao Y, Wang S, Wang X, et al. Molecular subtypes of neuroendocrine carcinomas: A cross-tissue classification framework based on five transcriptional regulators. Cancer Cell. 2024;42:1106-1125.e8 pubmed publisher
Park S, Hong T, Hwang S, Heeke S, Gay C, Kim J, et al. Comprehensive analysis of transcription factor-based molecular subtypes and their correlation to clinical outcomes in small-cell lung cancer. EBioMedicine. 2024;102:105062 pubmed publisher
Kim J, Kim S, Park S, Lee G, Lim K, Kim J, et al. Molecular Subtypes and Tumor Microenvironment Characteristics of Small-Cell Lung Cancer Associated with Platinum-Resistance. Cancers (Basel). 2023;15: pubmed publisher
Hwang S, Hong T, Kim H, Choi Y, Zo J, Shim Y, et al. Whole-Section Landscape Analysis of Molecular Subtypes in Curatively Resected Small Cell Lung Cancer: Clinicopathologic Features and Prognostic Significance. Mod Pathol. 2023;36:100184 pubmed publisher
Tian Y, Li Q, Yang Z, Zhang S, Xu J, Wang Z, et al. Single-cell transcriptomic profiling reveals the tumor heterogeneity of small-cell lung cancer. Signal Transduct Target Ther. 2022;7:346 pubmed publisher
Hwang S, Hong T, Park S, Jung H, Sun J, Ahn J, et al. Molecular subtypes of small cell lung cancer transformed from adenocarcinoma after EGFR tyrosine kinase inhibitor treatment. Transl Lung Cancer Res. 2021;10:4209-4220 pubmed publisher
Cai L, Liu H, Huang F, Fujimoto J, Girard L, Chen J, et al. Cell-autonomous immune gene expression is repressed in pulmonary neuroendocrine cells and small cell lung cancer. Commun Biol. 2021;4:314 pubmed publisher
Gay C, Stewart C, Park E, Diao L, Groves S, Heeke S, et al. Patterns of transcription factor programs and immune pathway activation define four major subtypes of SCLC with distinct therapeutic vulnerabilities. Cancer Cell. 2021;39:346-360.e7 pubmed publisher
Day Y, Liou J, Lee C, Lin Y, Mao C, Chou A, et al. Lack of interleukin-17 leads to a modulated micro-environment and amelioration of mechanical hypersensitivity after peripheral nerve injury in mice. Pain. 2014;155:1293-302 pubmed publisher
Hata H, Sakaguchi N, Yoshitomi H, Iwakura Y, Sekikawa K, Azuma Y, et al. Distinct contribution of IL-6, TNF-alpha, IL-1, and IL-10 to T cell-mediated spontaneous autoimmune arthritis in mice. J Clin Invest. 2004;114:582-8 pubmed
product information
brand :
Novus
catalog number base :
NBP1-83966
SKU :
NBP1-83966
product name :
POU2F3 Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The POU2F3 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to POU2F3. This antibody reacts with human. The POU2F3 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen.
target :
POU2F3
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFN
RQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLN
ASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
POU2F3
review stars :
5
Antibody validation :
Orthogonal Validation
top caption :
Immunohistochemistry-Paraffin: POU2F3 Antibody [NBP1-83966]
applications :
IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen
USD :
569 USD
alt names :
Epoc-1, MGC126698, oct-11, OCT11FLJ40063, Octamer-binding protein 11, Octamer-binding transcription factor 11, OTF11, OTF-11, PLA1, PLA-1, POU class 2 homeobox 3, POU domain class 2, transcription factor 3, POU domain, class 2, transcription factor 3, POU transcription factor, Skn-1a, Transcription factor PLA-1, Transcription factor Skn-1
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.