POU2F3 Antibody - BSA Free | Novus Biologicals NBP1-83966 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

POU2F3 Antibody - BSA Free

catalog :

NBP1-83966

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

RA3-6B2

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Kim J, Kim S, Park S, Lee G, Lim K, Kim J, et al. Molecular Subtypes and Tumor Microenvironment Characteristics of Small-Cell Lung Cancer Associated with Platinum-Resistance. Cancers (Basel). 2023;15: pubmed publisher
Hwang S, Hong T, Kim H, Choi Y, Zo J, Shim Y, et al. Whole-Section Landscape Analysis of Molecular Subtypes in Curatively Resected Small Cell Lung Cancer: Clinicopathologic Features and Prognostic Significance. Mod Pathol. 2023;36:100184 pubmed publisher
Tian Y, Li Q, Yang Z, Zhang S, Xu J, Wang Z, et al. Single-cell transcriptomic profiling reveals the tumor heterogeneity of small-cell lung cancer. Signal Transduct Target Ther. 2022;7:346 pubmed publisher
Hwang S, Hong T, Park S, Jung H, Sun J, Ahn J, et al. Molecular subtypes of small cell lung cancer transformed from adenocarcinoma after EGFR tyrosine kinase inhibitor treatment. Transl Lung Cancer Res. 2021;10:4209-4220 pubmed publisher
Cai L, Liu H, Huang F, Fujimoto J, Girard L, Chen J, et al. Cell-autonomous immune gene expression is repressed in pulmonary neuroendocrine cells and small cell lung cancer. Commun Biol. 2021;4:314 pubmed publisher
Gay C, Stewart C, Park E, Diao L, Groves S, Heeke S, et al. Patterns of transcription factor programs and immune pathway activation define four major subtypes of SCLC with distinct therapeutic vulnerabilities. Cancer Cell. 2021;39:346-360.e7 pubmed publisher
Day Y, Liou J, Lee C, Lin Y, Mao C, Chou A, et al. Lack of interleukin-17 leads to a modulated micro-environment and amelioration of mechanical hypersensitivity after peripheral nerve injury in mice. Pain. 2014;155:1293-302 pubmed publisher
Hata H, Sakaguchi N, Yoshitomi H, Iwakura Y, Sekikawa K, Azuma Y, et al. Distinct contribution of IL-6, TNF-alpha, IL-1, and IL-10 to T cell-mediated spontaneous autoimmune arthritis in mice. J Clin Invest. 2004;114:582-8 pubmed

product information

master code :

NBP1-83966

SKU :

NBP1-83966

product name :

POU2F3 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The POU2F3 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to POU2F3. This antibody reacts with human. The POU2F3 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,IF/IHC,Western Blot,Immunohistochemistry-Frozen.

target :

POU2F3

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

LESMHTDIKMSGDVADSTDARSTLSQVEPGNDRNGLDFN
RQIKTEDLSDSLQQTLSHRPCHLSQGPAMMSGNQMSGLN
ASPCQDMASLHPLQQLVLVPGHLQSVSQFLLSQTQP
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

POU2F3

Antibody validation :

Orthogonal Validation

applications :

Immunohistochemistry,Immunohistochemistry-Paraffin,IF/IHC,Western Blot,Immunohistochemistry-Frozen

USD :

569 USD

alt names :

Epoc-1, MGC126698, oct-11, OCT11FLJ40063, Octamer-binding protein 11, Octamer-binding transcription factor 11, OTF11, OTF-11, PLA1, PLA-1, POU class 2 homeobox 3, POU domain class 2, transcription factor 3, POU domain, class 2, transcription factor 3, POU transcription factor, Skn-1a, Transcription factor PLA-1, Transcription factor Skn-1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage