product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
PLVAP Antibody - BSA Free
catalog :
NBP1-83911
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
12-A1-1
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 11
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry - paraffin section; human; 1:25; loading ...; fig 4d, 4e
Ramachandran P, Dobie R, Wilson Kanamori J, Dora E, Henderson B, Luu N, et al. Resolving the fibrotic niche of human liver cirrhosis at single-cell level. Nature. 2019;575:512-518 pubmed publisher
Shuhan W, Jinxiao L, Luorui S, Liuying C, Fangyuan Z, Mengqi Z, et al. Dachengqi decoction ameliorated liver injury in liver fibrosis mice by maintaining gut vascular barrier integrity. Phytomedicine. 2025;136:156272 pubmed publisher
Wilkinson A, Hulme S, Kennedy J, Mann E, Horn P, Shepherd E, et al. The senescent secretome drives PLVAP expression in cultured human hepatic endothelial cells to promote monocyte transmigration. iScience. 2023;26:107966 pubmed publisher
Sawada A, Kawanishi K, Igarashi Y, Taneda S, Hattori M, Ishida H, et al. Overexpression of Plasmalemmal Vesicle-Associated Protein-1 Reflects Glomerular Endothelial Injury in Cases of Proliferative Glomerulonephritis with Monoclonal IgG Deposits. Kidney Int Rep. 2023;8:151-163 pubmed publisher
Yokomori H, Ando W, Oda M. Plasmalemmal Vesicle-Associated Protein Is Associated with Endothelial Cells Sprouting from the Peribiliary Capillary Plexus in Human Cirrhotic Liver. J Vasc Res. 2021;58:361-369 pubmed publisher
Xie Y, He L, Lugano R, Zhang Y, Cao H, He Q, et al. Key molecular alterations in endothelial cells in human glioblastoma uncovered through single-cell RNA sequencing. JCI Insight. 2021;6: pubmed publisher
Roselló Díez A, Madisen L, Bastide S, Zeng H, Joyner A. Cell-nonautonomous local and systemic responses to cell arrest enable long-bone catch-up growth in developing mice. PLoS Biol. 2018;16:e2005086 pubmed publisher
Zhang X, Hagen J, Muniz V, Smith T, Coombs G, Eischen C, et al. RABL6A, a novel RAB-like protein, controls centrosome amplification and chromosome instability in primary fibroblasts. PLoS ONE. 2013;8:e80228 pubmed publisher
Apicelli A, Maggi L, Hirbe A, Miceli A, Olanich M, Schulte Winkeler C, et al. A non-tumor suppressor role for basal p19ARF in maintaining nucleolar structure and function. Mol Cell Biol. 2008;28:1068-80 pubmed
Hernando E, Charytonowicz E, Dudas M, Menendez S, Matushansky I, Mills J, et al. The AKT-mTOR pathway plays a critical role in the development of leiomyosarcomas. Nat Med. 2007;13:748-53 pubmed
Klochendler Yeivin A, Picarsky E, Yaniv M. Increased DNA damage sensitivity and apoptosis in cells lacking the Snf5/Ini1 subunit of the SWI/SNF chromatin remodeling complex. Mol Cell Biol. 2006;26:2661-74 pubmed
product information
brand :
Novus
catalog number base :
NBP1-83911
SKU :
NBP1-83911
product name :
PLVAP Antibody - BSA Free
units size :
0.1 ml (also 25 ul)
description :
The PLVAP Antibody - BSA Free from Novus is a rabbit polyclonal antibody to PLVAP. This antibody reacts with human. The PLVAP Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Electron Microscopy.
target :
PLVAP
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNL
GYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRA
DIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQA
REAKLQAECSR
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
PLVAP
review stars :
4
top caption :
Western Blot: PLVAP Antibody [NBP1-83911]
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Electron Microscopy
USD :
559 USD
alt names :
FELSfenestrated-endothelial linked structure protein; PV-1 protein, Fenestrated endothelial-linked structure protein, gp68, plasmalemma vesicle associated protein, PV1Plasmalemma vesicle protein 1, PV-1plasmalemma vesicle-associated protein
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.