PLVAP Antibody - BSA Free | Novus Biologicals NBP1-83911 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

PLVAP Antibody - BSA Free

catalog :

NBP1-83911

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

12-A1-1

reactivity :

human

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 10

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry - paraffin section; human; 1:25; loading ...; fig 4d, 4e	Ramachandran P, Dobie R, Wilson Kanamori J, Dora E, Henderson B, Luu N, et al. Resolving the fibrotic niche of human liver cirrhosis at single-cell level. Nature. 2019;575:512-518 pubmed publisher
	Wilkinson A, Hulme S, Kennedy J, Mann E, Horn P, Shepherd E, et al. The senescent secretome drives PLVAP expression in cultured human hepatic endothelial cells to promote monocyte transmigration. iScience. 2023;26:107966 pubmed publisher
	Sawada A, Kawanishi K, Igarashi Y, Taneda S, Hattori M, Ishida H, et al. Overexpression of Plasmalemmal Vesicle-Associated Protein-1 Reflects Glomerular Endothelial Injury in Cases of Proliferative Glomerulonephritis with Monoclonal IgG Deposits. Kidney Int Rep. 2023;8:151-163 pubmed publisher
	Yokomori H, Ando W, Oda M. Plasmalemmal Vesicle-Associated Protein Is Associated with Endothelial Cells Sprouting from the Peribiliary Capillary Plexus in Human Cirrhotic Liver. J Vasc Res. 2021;58:361-369 pubmed publisher
	Xie Y, He L, Lugano R, Zhang Y, Cao H, He Q, et al. Key molecular alterations in endothelial cells in human glioblastoma uncovered through single-cell RNA sequencing. JCI Insight. 2021;6: pubmed publisher
	Roselló Díez A, Madisen L, Bastide S, Zeng H, Joyner A. Cell-nonautonomous local and systemic responses to cell arrest enable long-bone catch-up growth in developing mice. PLoS Biol. 2018;16:e2005086 pubmed publisher
	Zhang X, Hagen J, Muniz V, Smith T, Coombs G, Eischen C, et al. RABL6A, a novel RAB-like protein, controls centrosome amplification and chromosome instability in primary fibroblasts. PLoS ONE. 2013;8:e80228 pubmed publisher
	Apicelli A, Maggi L, Hirbe A, Miceli A, Olanich M, Schulte Winkeler C, et al. A non-tumor suppressor role for basal p19ARF in maintaining nucleolar structure and function. Mol Cell Biol. 2008;28:1068-80 pubmed
	Hernando E, Charytonowicz E, Dudas M, Menendez S, Matushansky I, Mills J, et al. The AKT-mTOR pathway plays a critical role in the development of leiomyosarcomas. Nat Med. 2007;13:748-53 pubmed
	Klochendler Yeivin A, Picarsky E, Yaniv M. Increased DNA damage sensitivity and apoptosis in cells lacking the Snf5/Ini1 subunit of the SWI/SNF chromatin remodeling complex. Mol Cell Biol. 2006;26:2661-74 pubmed

product information

master code :

NBP1-83911

SKU :

NBP1-83911

product name :

PLVAP Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The PLVAP Antibody - BSA Free from Novus is a rabbit polyclonal antibody to PLVAP. This antibody reacts with human. The PLVAP Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry-Paraffin,Electron Microscopy,Immunohistochemistry.

target :

PLVAP

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

KEQLQKVQALCLPLDKDKFEMDLRNLWRDSIIPRSLDNL
GYNLYHPLGSELASIRRACDHMPSLMSSKVEELARSLRA
DIERVARENSDLQRQKLEAQQGLRASQEAKQKVEKEAQA
REAKLQAECSR
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

PLVAP

applications :

Western Blot,Immunohistochemistry-Paraffin,Electron Microscopy,Immunohistochemistry

USD :

559 USD

alt names :

FELSfenestrated-endothelial linked structure protein; PV-1 protein, Fenestrated endothelial-linked structure protein, gp68, plasmalemma vesicle associated protein, PV1Plasmalemma vesicle protein 1, PV-1plasmalemma vesicle-associated protein

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage