product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
TSSK1 Antibody - BSA Free
catalog :
NBP1-83883
quantity :
0.1 ml
price :
499 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP1-83883
SKU :
NBP1-83883
product name :
TSSK1 Antibody - BSA Free
unit size :
0.1 ml
description :
The TSSK1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TSSK1. This antibody reacts with human. The TSSK1 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
TSSK1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
KSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFP
SKPSTMETEEGPPQQPPETR
This antibody was developed against Recombinant Protein corresponding to amino acids:
SKPSTMETEEGPPQQPPETR
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
TSSK1B
Antibody validation :
Orthogonal Validation
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
499 USD
alt names :
EC 2.7.11, serine/threonine kinase 22D (spermiogenesis associated), Serine/threonine-protein kinase 22A, spermiogenesis associated 4, SPOGA1, SPOGA4EC 2.7.11.1, STK22A, STK22DFKSG81, Testis-specific kinase 1, testis-specific serine kinase 1, testis-specific serine kinase 1B, testis-specific serine/threonine-protein kinase 1, TSK-1, TSSK-1, TSSK1serine/threonine kinase FKSG81
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
