product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
OGFOD1 Antibody - BSA Free
catalog :
NBP1-83826
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
A103 + M2-7C10 + M2-9E3
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
| Reference |
|---|
Kim J, Lee S, Lee J, Chun S, Kang B, Kwak S, et al. OGFOD1 is required for breast cancer cell proliferation and is associated with poor prognosis in breast cancer. Oncotarget. 2015;6:19528-41 pubmed
|
product information
master code :
NBP1-83826
SKU :
NBP1-83826
product name :
OGFOD1 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The OGFOD1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to OGFOD1. This antibody reacts with human,mouse,rat. The OGFOD1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
OGFOD1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
EPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQ
GELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEY
GGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVK
HINHRSLEQKKTFPNRTGFWDFSF
This antibody was developed against Recombinant Protein corresponding to amino acids:
GELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEY
GGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVK
HINHRSLEQKKTFPNRTGFWDFSF
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Rat
gene symbol :
OGFOD1
applications :
IF/IHC,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
559 USD
alt names :
2-oxoglutarate and iron-dependent oxygenase domain containing 1,2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1, EC 1.14.11, FLJ10826, KIAA1612TPA1, termination and polyadenylation 1, homolog, Termination and polyadenylation 1 homolog, TPA1EC 1.14.11.-
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
