ARID5B Antibody - BSA Free | Novus Biologicals NBP1-83622 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ARID5B Antibody - BSA Free

catalog :

NBP1-83622

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 13

Reference
Tagawa Y, Saito T, Iwai H, Sato M, Noda S, Yamamoto A, et al. ARID5B is a negative modulator of IL-6 production in rheumatoid arthritis synovial fibroblasts. Immunol Med. 2024;47:176-185 pubmed publisher
Tan Y, Qiao J, Yang S, Wang Q, Liu H, Liu Q, et al. ARID5B-mediated LINC01128 epigenetically activated pyroptosis and apoptosis by promoting the formation of the BTF3/STAT3 complex in β2GPI/anti-β2GPI-treated monocytes. Clin Transl Med. 2024;14:e1539 pubmed publisher
Deng Y, Dong Y, Wu L, Zhang Q, Yang L. ARID5B promoted the histone demethylation of SORBS2 and hampered the metastasis of ovarian cancer. Pathol Res Pract. 2023;252:154911 pubmed publisher
Xiang Y, Liang B, Zhang X, Qiu X, Deng Q, Yu L, et al. Atheroprotective mechanism by which folic acid regulates monocyte subsets and function through DNA methylation. Clin Epigenetics. 2022;14:32 pubmed publisher
Xu H, Zhao X, Bhojwani D, E S, Goodings C, Zhang H, et al. ARID5B Influences Antimetabolite Drug Sensitivity and Prognosis of Acute Lymphoblastic Leukemia. Clin Cancer Res. 2020;26:256-264 pubmed publisher
Chen X, Hu Y, Zhang W, Chen K, Hu J, Li X, et al. Cisplatin induces autophagy to enhance hepatitis B virus replication via activation of ROS/JNK and inhibition of the Akt/mTOR pathway. Free Radic Biol Med. 2019;131:225-236 pubmed publisher
Dai S, Chen X, Yu Y, Zang G, Tang Z. Immunization with lentiviral vector‑modified dendritic cells encoding ubiquitinated hepatitis B core antigen promotes Th1 differentiation and antiviral immunity by enhancing p38 MAPK and JNK activation in HBV transgenic mice. Mol Med Rep. 2018;18:4691-4699 pubmed publisher
Cichocki F, Wu C, Zhang B, Felices M, Tesi B, Tuininga K, et al. ARID5B regulates metabolic programming in human adaptive NK cells. J Exp Med. 2018;215:2379-2395 pubmed publisher
Li X, Pan E, Zhu J, Xu L, Chen X, Li J, et al. Cisplatin Enhances Hepatitis B Virus Replication and PGC-1Î± Expression through Endoplasmic Reticulum Stress. Sci Rep. 2018;8:3496 pubmed publisher
Shen Z, Yang H, Yang S, Wang W, Cui X, Zhou X, et al. Hepatitis B virus persistence in mice reveals IL-21 and IL-33 as regulators of viral clearance. Nat Commun. 2017;8:2119 pubmed publisher
Zhou H, Gewaily D, Ahn S, Preskill C, Wang Y, Zong L, et al. Sequence analysis and functional characterization of full-length hepatitis B virus genomes from Korean cirrhotic patients with or without liver cancer. Virus Res. 2017;235:86-95 pubmed publisher
Li J, Zong L, Sureau C, Barker L, Wands J, Tong S. Unusual Features of Sodium Taurocholate Cotransporting Polypeptide as a Hepatitis B Virus Receptor. J Virol. 2016;90:8302-13 pubmed publisher
Nestor C, Ottaviano R, Reinhardt D, Cruickshanks H, Mjoseng H, McPherson R, et al. Rapid reprogramming of epigenetic and transcriptional profiles in mammalian culture systems. Genome Biol. 2015;16:11 pubmed publisher

product information

master code :

NBP1-83622

SKU :

NBP1-83622

product name :

ARID5B Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The ARID5B Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ARID5B. This antibody reacts with human,mouse. The ARID5B Antibody - BSA Free has been validated for the following applications: Chemotaxis,Western Blot,Immunohistochemistry-Paraffin,Chromatin Immunoprecipitation (ChIP),Immunocytochemistry/ Immunofluorescence.

target :

ARID5B

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

TSKYPSRDMYRESENSSFPSHRHQEKLHVNYLTSLHLQD
KKSAAAEAPTDDQPTDLSLPKNPHKPTGKVLGLAHSTTG
PQESKGISQFQVLGSQSRDCHPKACRVSPMTMSGPKKYP
ESLSRSGKPHHVRLENFRKME
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

ARID5B

applications :

Chemotaxis,Western Blot,Immunohistochemistry-Paraffin,Chromatin Immunoprecipitation (ChIP),Immunocytochemistry/ Immunofluorescence

USD :

569 USD

alt names :

ARID domain-containing protein 5B, AT rich interactive domain 5B (MRF1-like), DESRTAT-rich interactive domain-containing protein 5B, FLJ21150, Modulator recognition factor 2, modulator recognition factor 2 (MRF2), MRF-2, MRF2MRF1-like protein

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage