product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SDE2 Antibody - BSA Free
catalog :
NBP1-83502
quantity :
0.1 ml (also 25 ul)
price :
499 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
product information
master code :
NBP1-83502
SKU :
NBP1-83502
product name :
SDE2 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The SDE2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to SDE2. This antibody reacts with human. The SDE2 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
SDE2
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
ETQEKKAESKEPIEEEPTGAGLNKDKETEERTDGERVAE
VAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAE
LELLGLEKLKCELMA
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
SDE2
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
499 USD
alt names :
C1orf55, chromosome 1 open reading frame 55, dJ671D7.1, FLJ35382, hypothetical protein LOC163859, RP4-671D7.1, SDE2 telomere maintenance homolog (S. pombe)
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.