DDX21 Antibody - BSA Free | Novus Biologicals NBP1-83310 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

DDX21 Antibody - BSA Free

catalog :

NBP1-83310

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

M5/114.15.2

reactivity :

human, mouse, zebrafish

application :

western blot, immunohistochemistry, immunocytochemistry, chromatin immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 15

Reference
Miao W, Porter D, Lopez Pajares V, Siprashvili Z, Meyers R, Bai Y, et al. Glucose dissociates DDX21 dimers to regulate mRNA splicing and tissue differentiation. Cell. 2023;186:80-97.e26 pubmed publisher
Shao W, Bi X, Pan Y, Gao B, Wu J, Yin Y, et al. Phase separation of RNA-binding protein promotes polymerase binding and transcription. Nat Chem Biol. 2022;18:70-80 pubmed publisher
Koltowska K, Okuda K, Gloger M, Rondon Galeano M, Mason E, Xuan J, et al. The RNA helicase Ddx21 controls Vegfc-driven developmental lymphangiogenesis by balancing endothelial cell ribosome biogenesis and p53 function. Nat Cell Biol. 2021;23:1136-1147 pubmed publisher
McMahon K, Stroud D, Gambin Y, Tillu V, Bastiani M, Sierecki E, et al. Cavin3 released from caveolae interacts with BRCA1 to regulate the cellular stress response. elife. 2021;10: pubmed publisher
Putra V, Hulme A, Tee A, Sun J, Atmadibrata B, Ho N, et al. The RNA-helicase DDX21 upregulates CEP55 expression and promotes neuroblastoma. Mol Oncol. 2021;15:1162-1179 pubmed publisher
Santoriello C, Sporrij A, Yang S, Flynn R, Henriques T, Dorjsuren B, et al. RNA helicase DDX21 mediates nucleotide stress responses in neural crest and melanoma cells. Nat Cell Biol. 2020;22:372-379 pubmed publisher
Loffredo Verde E, Bhattacharjee S, Malo A, Festag J, Kosinska A, Ringelhan M, et al. Dynamic, Helminth-Induced Immune Modulation Influences the Outcome of Acute and Chronic Hepatitis B Virus Infection. J Infect Dis. 2020;221:1448-1461 pubmed publisher
O CONNOR T, Zhou X, Kosla J, Adili A, García Beccaria M, Kotsiliti E, et al. Age-Related Gliosis Promotes Central Nervous System Lymphoma through CCL19-Mediated Tumor Cell Retention. Cancer Cell. 2019;36:250-267.e9 pubmed publisher
Argaud D, Boulanger M, Chignon A, Mkannez G, Mathieu P. Enhancer-mediated enrichment of interacting JMJD3-DDX21 to ENPP2 locus prevents R-loop formation and promotes transcription. Nucleic Acids Res. 2019;: pubmed publisher
Bi X, Xu Y, Li T, Li X, Li W, Shao W, et al. RNA Targets Ribogenesis Factor WDR43 to Chromatin for Transcription and Pluripotency Control. Mol Cell. 2019;: pubmed publisher
Seehawer M, Heinzmann F, D Artista L, Harbig J, Roux P, Hoenicke L, et al. Necroptosis microenvironment directs lineage commitment in liver cancer. Nature. 2018;562:69-75 pubmed publisher
Calo E, Gu B, Bowen M, Aryan F, Zalc A, Liang J, et al. Tissue-selective effects of nucleolar stress and rDNA damage in developmental disorders. Nature. 2018;554:112-117 pubmed publisher
Matsuzaka Y, Tanihata J, Komaki H, Ishiyama A, Oya Y, Ruegg U, et al. Characterization and Functional Analysis of Extracellular Vesicles and Muscle-Abundant miRNAs (miR-1, miR-133a, and miR-206) in C2C12 Myocytes and mdx Mice. PLoS ONE. 2016;11:e0167811 pubmed publisher
Calo E, Flynn R, Martin L, Spitale R, Chang H, Wysocka J. RNA helicase DDX21 coordinates transcription and ribosomal RNA processing. Nature. 2015;518:249-53 pubmed publisher
Huang L, Wohlleber D, Reisinger F, Jenne C, Cheng R, Abdullah Z, et al. Intrahepatic myeloid-cell aggregates enable local proliferation of CD8(+) T cells and successful immunotherapy against chronic viral liver infection. Nat Immunol. 2013;14:574-83 pubmed publisher

product information

master code :

NBP1-83310

SKU :

NBP1-83310

product name :

DDX21 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The DDX21 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to DDX21. This antibody reacts with human,mouse,zebrafish,fish - danio rerio (zebrafish). The DDX21 Antibody - BSA Free has been validated for the following applications: In vitro assay,Chemotaxis,Western Blot,Knockdown Validated,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Chromatin Immunoprecipitation (ChIP).

target :

DDX21

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPK
SKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Zebrafish,Fish - Danio rerio (Zebrafish)

gene symbol :

DDX21

Antibody validation :

Orthogonal Validation

applications :

Chemotaxis,Western Blot,In vitro assay,Knockdown Validated,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Chromatin Immunoprecipitation (ChIP)

USD :

559 USD

alt names :

DEAD (Asp-Glu-Ala-Asp) box polypeptide 21, DEAD box protein 21, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21, DKFZp686F21172, EC 3.6.1, EC 3.6.4.13, Gu protein, GUA, gu-alpha, GURDB, nucleolar RNA helicase 2, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu, RH-II/GU, RH-II/GuA, RNA helicase II/Gu alpha

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage