ATRX Antibody - BSA Free | Novus Biologicals NBP1-83077 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ATRX Antibody - BSA Free

catalog :

NBP1-83077

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 28

Reference
Minniti G, Paolini S, Antonelli M, Gianno F, Tini P, Lanzetta G, et al. Long-term treatment outcomes of temozolomide-based chemoradiation in patients with adult-type diffuse IDH-mutant grade 2 astrocytoma. J Neurooncol. 2023;164:331-339 pubmed publisher
Familiari P, Relucenti M, Lapolla P, Palmieri M, Antonelli M, Cristiano L, et al. Adult IDH Wild-Type Glioblastoma Ultrastructural Investigation Suggests a Possible Correlation between Morphological Biomarkers and Ki-67 Index. Biomedicines. 2023;11: pubmed publisher
Familiari P, Lapolla P, Picotti V, Palmieri M, Pesce A, Carosi G, et al. Role of 1p/19q Codeletion in Diffuse Low-grade Glioma Tumour Prognosis. Anticancer Res. 2023;43:2659-2670 pubmed publisher
Zhang P, He Z, Yao X, Tang R, Ma J, Luo T, et al. COVID-19-associated monocytic encephalitis (CAME): histological and proteomic evidence from autopsy. Signal Transduct Target Ther. 2023;8:24 pubmed publisher
Alzoubi H, Minasi S, Gianno F, Antonelli M, Belardinilli F, Giangaspero F, et al. Alternative Lengthening of Telomeres (ALT) and Telomerase Reverse Transcriptase Promoter Methylation in Recurrent Adult and Primary Pediatric Pituitary Neuroendocrine Tumors. Endocr Pathol. 2022;33:494-505 pubmed publisher
Gianno F, Antonelli M, Di Dio T, Minasi S, Donofrio V, Buccoliero A, et al. Correlation Between Immunohistochemistry and Sequencing in H3G34-Mutant Gliomas. Am J Surg Pathol. 2021;45:200-204 pubmed publisher
Minasi S, Baldi C, Gianno F, Antonelli M, Buccoliero A, Pietsch T, et al. Alternative lengthening of telomeres in molecular subgroups of paediatric high-grade glioma. Childs Nerv Syst. 2020;: pubmed publisher
Verma V, Kumar P, Gupta S, Yadav S, Dhanda R, Thorlacius H, et al. α-Hemolysin of uropathogenic E. coli regulates NLRP3 inflammasome activation and mitochondrial dysfunction in THP-1 macrophages. Sci Rep. 2020;10:12653 pubmed publisher
Dang S, Zhang Z, LI K, Zheng J, Qian L, Liu X, et al. Blockade of β-adrenergic signaling suppresses inflammasome and alleviates cardiac fibrosis. Ann Transl Med. 2020;8:127 pubmed publisher
Verma V, Gupta S, Kumar P, Yadav S, Dhanda R, Gaind R, et al. Involvement of NLRP3 and NLRC4 Inflammasome in Uropathogenic E. coli Mediated Urinary Tract Infections. Front Microbiol. 2019;10:2020 pubmed publisher
Lage S, Dominical V, Wong C, Sereti I. Evaluation of Canonical Inflammasome Activation in Human Monocytes by Imaging Flow Cytometry. Front Immunol. 2019;10:1284 pubmed publisher
Cornelius D, Baik C, Travis O, White D, Young C, Austin Pierce W, et al. NLRP3 inflammasome activation in platelets in response to sepsis. Physiol Rep. 2019;7:e14073 pubmed publisher
Minasi S, Baldi C, Pietsch T, Donofrio V, Pollo B, Antonelli M, et al. Telomere elongation via alternative lengthening of telomeres (ALT) and telomerase activation in primary metastatic medulloblastoma of childhood. J Neurooncol. 2019;142:435-444 pubmed publisher
Wang X, Pan J, Liu H, Zhang M, Liu D, Lu L, et al. AIM2 gene silencing attenuates diabetic cardiomyopathy in type 2 diabetic rat model. Life Sci. 2019;221:249-258 pubmed publisher
Kariya S, Okano M, Zhao P, Maeda Y, Kataoka Y, Higaki T, et al. NLRP3 inflammasome expression in lipopolysaccharide-induced otitis media. Acta Otolaryngol. 2018;138:1061-1065 pubmed publisher
Zhou L, Su X, Li B, Chu C, Sun H, Zhang N, et al. PM2.5 exposure impairs sperm quality through testicular damage dependent on NALP3 inflammasome and miR-183/96/182 cluster targeting FOXO1 in mouse. Ecotoxicol Environ Saf. 2019;169:551-563 pubmed publisher
Li X, Oh S, Song H, Shin S, Zhang B, Freeman W, et al. A potential common role of the Jumonji C domain-containing 1A histone demethylase and chromatin remodeler ATRX in promoting colon cancer. Oncol Lett. 2018;16:6652-6662 pubmed publisher
Cohen T, Boland M, Boland B, Takahashi V, Tovchigrechko A, Lee Y, et al. S. aureus Evades Macrophage Killing through NLRP3-Dependent Effects on Mitochondrial Trafficking. Cell Rep. 2018;22:2431-2441 pubmed publisher
Liang Y, Liang S, Zhang Y, Deng Y, He Y, Chen Y, et al. Oral Administration of Compound Probiotics Ameliorates HFD-Induced Gut Microbe Dysbiosis and Chronic Metabolic Inflammation via the G Protein-Coupled Receptor 43 in Non-alcoholic Fatty Liver Disease Rats. Probiotics Antimicrob Proteins. 2019;11:175-185 pubmed publisher
Zhang B, Xu D, She L, Wang Z, Yang N, Sun R, et al. Silybin inhibits NLRP3 inflammasome assembly through the NAD+/SIRT2 pathway in mice with nonalcoholic fatty liver disease. FASEB J. 2018;32:757-767 pubmed publisher
Macpherson M, Westbom C, Kogan H, Shukla A. Actin polymerization plays a significant role in asbestos-induced inflammasome activation in mesothelial cells in vitro. Histochem Cell Biol. 2017;147:595-604 pubmed publisher
Kim S, Cha J, Kang H, Lee J, Lee J, Park J, et al. Corosolic acid ameliorates acute inflammation through inhibition of IRAK-1 phosphorylation in macrophages. BMB Rep. 2016;49:276-81 pubmed
Kariya S, Okano M, Zhao P, Kataoka Y, Yoshinobu J, Maeda Y, et al. Activation of NLRP3 inflammasome in human middle ear cholesteatoma and chronic otitis media. Acta Otolaryngol. 2016;136:136-40 pubmed publisher
Yao X, Carlson D, Sun Y, Ma L, Wolf S, Minei J, et al. Mitochondrial ROS Induces Cardiac Inflammation via a Pathway through mtDNA Damage in a Pneumonia-Related Sepsis Model. PLoS ONE. 2015;10:e0139416 pubmed publisher
Yoshida M, Ogawa R, Yoshida H, Maeshima A, Kanai Y, Kinoshita T, et al. TERT promoter mutations are frequent and show association with MED12 mutations in phyllodes tumors of the breast. Br J Cancer. 2015;113:1244-8 pubmed publisher
Napier C, Huschtscha L, Harvey A, Bower K, Noble J, Hendrickson E, et al. ATRX represses alternative lengthening of telomeres. Oncotarget. 2015;6:16543-58 pubmed
Hayashi S, Sasaki H, Kimura T, Abe T, Nakamura T, Kitamura Y, et al. Molecular-genetic and clinical characteristics of gliomas with astrocytic appearance and total 1p19q loss in a single institutional consecutive cohort. Oncotarget. 2015;6:15871-81 pubmed
Fishbein L, Khare S, Wubbenhorst B, Desloover D, D Andrea K, Merrill S, et al. Whole-exome sequencing identifies somatic ATRX mutations in pheochromocytomas and paragangliomas. Nat Commun. 2015;6:6140 pubmed publisher

product information

master code :

NBP1-83077

SKU :

NBP1-83077

product name :

ATRX Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The ATRX Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ATRX. This antibody reacts with human. The ATRX Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.

target :

ATRX

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPF
NLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPL
EDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREA
IYNDVLTKQQMLISCVQRILMNRR
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

gene symbol :

ATRX

Antibody validation :

Knockout/Knockdown

applications :

IF/IHC,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

alpha thalassemia/mental retardation syndrome X-linked, alpha thalassemia/mental retardation syndrome X-linked (RAD54 (S. cerevisiae)homolog), alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.cerevisiae), ATP-dependent helicase ATRX, ATR2, DNA dependent ATPase and helicase, EC 3.6.1, EC 3.6.4.12, helicase 2, X-linked, Juberg-Marsidi syndrome, MGC2094, MRXHF1, RAD54 homolog, RAD54L, SFM1, SHS, transcriptional regulator ATRX, XH2RAD54, X-linked helicase II, X-linked nuclear protein, XNPZNF-HX, Zinc finger helicase, Znf-HX

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage