product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ZEB2 Antibody - BSA Free
catalog :
NBP1-82991
quantity :
0.1 ml (also 25 ul)
price :
579 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
L2
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
more info or order :
citations: 41
Published Application/Species/Sample/DilutionReference
  • western blot; mouse; 1:1000; fig s2
Lohraseb I, McCarthy P, Secker G, Marchant C, Wu J, Ali N, et al. Global ubiquitinome profiling identifies NEDD4 as a regulator of Profilin 1 and actin remodelling in neural crest cells. Nat Commun. 2022;13:2018 pubmed publisher
  • immunohistochemistry; human; 1:10; fig 7
Lee E, Wang J, Yumoto K, Jung Y, Cackowski F, Decker A, et al. DNMT1 Regulates Epithelial-Mesenchymal Transition and Cancer Stem Cells, Which Promotes Prostate Cancer Metastasis. Neoplasia. 2016;18:553-66 pubmed publisher
Kinouchi A, Jubashi T, Tatsuno R, Ichikawa J, Sakamoto K, Sakurai D, et al. Roles of ZEB1 and ZEB2 in E-cadherin expression and cell aggressiveness in head and neck cancer. Genes Cells. 2024;29:1131-1143 pubmed publisher
Park S, Yoon S, Choi S, Jung J, Park J, Park Y, et al. Particulate matter promotes cancer metastasis through increased HBEGF expression in macrophages. Exp Mol Med. 2022;54:1901-1912 pubmed publisher
Higgins S, Erath T, Desarno M, Reed D, Gaalema D, Sigmon S, et al. Leveraging the cigarette purchase task to understand relationships between cumulative vulnerabilities, the relative reinforcing effects of smoking, and response to reduced nicotine content cigarettes. Prev Med. 2022;165:107206 pubmed publisher
De Angelis M, Francescangeli F, Nicolazzo C, Xhelili E, La Torre F, Colace L, et al. An Orthotopic Patient-Derived Xenograft (PDX) Model Allows the Analysis of Metastasis-Associated Features in Colorectal Cancer. Front Oncol. 2022;12:869485 pubmed publisher
Ichikawa M, Endo K, Itoh Y, Osada A, Kimura Y, Ueki K, et al. Ets family proteins regulate the EMT transcription factors Snail and ZEB in cancer cells. FEBS Open Bio. 2022;12:1353-1364 pubmed publisher
Wang J, Farkas C, Benyoucef A, Carmichael C, Haigh K, Wong N, et al. Interplay between the EMT transcription factors ZEB1 and ZEB2 regulates hematopoietic stem and progenitor cell differentiation and hematopoietic lineage fidelity. PLoS Biol. 2021;19:e3001394 pubmed publisher
Lasierra Losada M, Pauler M, Vandamme N, Goossens S, Berx G, Leppkes M, et al. Pancreas morphogenesis and homeostasis depends on tightly regulated Zeb1 levels in epithelial cells. Cell Death Discov. 2021;7:138 pubmed publisher
Moro L, Simoneschi D, Kurz E, Arbini A, Jang S, Guaragnella N, et al. Epigenetic silencing of the ubiquitin ligase subunit FBXL7 impairs c-SRC degradation and promotes epithelial-to-mesenchymal transition and metastasis. Nat Cell Biol. 2020;22:1130-1142 pubmed publisher
Sorensen E, Seidel H, Crittenden S, Ballard J, Kimble J. A toolkit of tagged glp-1 alleles reveals strong glp-1 expression in the germline, embryo, and spermatheca. MicroPubl Biol. 2020;2020: pubmed publisher
Cai X, Feng S, Zhang J, Qiu W, Qian M, Wang Y. USP18 deubiquitinates and stabilizes Twist1 to promote epithelial-mesenchymal transition in glioblastoma cells. Am J Cancer Res. 2020;10:1156-1169 pubmed
Takemura M, Noborn F, Nilsson J, Bowden N, Nakato E, Baker S, et al. Chondroitin sulfate proteoglycan Windpipe modulates Hedgehog signaling in Drosophila. Mol Biol Cell. 2020;31:813-824 pubmed publisher
Lee C, Putnam A, Lu T, He S, Ouyang J, Seydoux G. Recruitment of mRNAs to P granules by condensation with intrinsically-disordered proteins. elife. 2020;9: pubmed publisher
Xu R, Zhou F, Yu T, Xu G, Zhang J, Wang Y, et al. MicroRNA-940 inhibits epithelial-mesenchymal transition of glioma cells via targeting ZEB2. Am J Transl Res. 2019;11:7351-7363 pubmed
Osada A, Endo K, Kimura Y, Sakamoto K, Nakamura R, Sakamoto K, et al. Addiction of mesenchymal phenotypes on the FGF/FGFR axis in oral squamous cell carcinoma cells. PLoS ONE. 2019;14:e0217451 pubmed publisher
Ouyang J, Folkmann A, Bernard L, Lee C, Seroussi U, Charlesworth A, et al. P Granules Protect RNA Interference Genes from Silencing by piRNAs. Dev Cell. 2019;50:716-728.e6 pubmed publisher
Wang P, Liu X, Han G, Dai S, Ni Q, Xiao S, et al. Downregulated lncRNA UCA1 acts as ceRNA to adsorb microRNA-498 to repress proliferation, invasion and epithelial mesenchymal transition of esophageal cancer cells by decreasing ZEB2 expression. Cell Cycle. 2019;18:2359-2376 pubmed publisher
Delaney K, Strobino M, Wenda J, Pankowski A, Steiner F. H3.3K27M-induced chromatin changes drive ectopic replication through misregulation of the JNK pathway in C. elegans. Nat Commun. 2019;10:2529 pubmed publisher
Hacker K, Benke S, Agerer B, Scinicariello S, Budroni V, Versteeg G. A repetitive acidic region contributes to the extremely rapid degradation of the cell-context essential protein TRIM52. Sci Rep. 2019;9:7901 pubmed publisher
Ordonez L, Hay T, McEwen R, Polanska U, Hughes A, Delpuech O, et al. Rapid activation of epithelial-mesenchymal transition drives PARP inhibitor resistance in Brca2-mutant mammary tumours. Oncotarget. 2019;10:2586-2606 pubmed publisher
Sales E, Heckman E, Warren T, Doe C. Regulation of subcellular dendritic synapse specificity by axon guidance cues. elife. 2019;8: pubmed publisher
Feng S, Cai X, Li Y, Jian X, Zhang L, Li B. Tripartite motif-containing 14 (TRIM14) promotes epithelial-mesenchymal transition via ZEB2 in glioblastoma cells. J Exp Clin Cancer Res. 2019;38:57 pubmed publisher
Sen S, Chanchani S, Southall T, Doe C. Neuroblast-specific open chromatin allows the temporal transcription factor, Hunchback, to bind neuroblast-specific loci. elife. 2019;8: pubmed publisher
Haldeman J, Conway A, Arlotto M, Slentz D, Muoio D, Becker T, et al. Creation of versatile cloning platforms for transgene expression and dCas9-based epigenome editing. Nucleic Acids Res. 2019;47:e23 pubmed publisher
Yang S, Toledo E, Rosmaninho P, Peng C, Uhlen P, Castro D, et al. A Zeb2-miR-200c loop controls midbrain dopaminergic neuron neurogenesis and migration. Commun Biol. 2018;1:75 pubmed publisher
Chen Y, Narimatsu Y, Clausen T, Gomes C, Karlsson R, Steentoft C, et al. The GAGOme: a cell-based library of displayed glycosaminoglycans. Nat Methods. 2018;15:881-888 pubmed publisher
Huang T, Niesman P, Arasu D, Lee D, De La Cruz A, Callejas A, et al. Tracing neuronal circuits in transgenic animals by transneuronal control of transcription (TRACT). elife. 2017;6: pubmed publisher
Lee C, Lu T, Seydoux G. Nanos promotes epigenetic reprograming of the germline by down-regulation of the THAP transcription factor LIN-15B. elife. 2017;6: pubmed publisher
Cichocki F, Valamehr B, Bjordahl R, Zhang B, Rezner B, Rogers P, et al. GSK3 Inhibition Drives Maturation of NK Cells and Enhances Their Antitumor Activity. Cancer Res. 2017;77:5664-5675 pubmed publisher
Paix A, Folkmann A, Seydoux G. Precision genome editing using CRISPR-Cas9 and linear repair templates in C. elegans. Methods. 2017;121-122:86-93 pubmed publisher
Smith J, Calidas D, Schmidt H, Lu T, Rasoloson D, Seydoux G. Spatial patterning of P granules by RNA-induced phase separation of the intrinsically-disordered protein MEG-3. elife. 2016;5: pubmed publisher
Couso I, Evans B, Li J, Liu Y, Ma F, Diamond S, et al. Synergism between Inositol Polyphosphates and TOR Kinase Signaling in Nutrient Sensing, Growth Control, and Lipid Metabolism in Chlamydomonas. Plant Cell. 2016;28:2026-2042 pubmed publisher
Hoshi Y, Endo K, Shirakihara T, Fukagawa A, Miyazawa K, Saitoh M. The potential role of regulator of G-protein signaling 16 in cell motility mediated by δEF1 family proteins. FEBS Lett. 2016;590:270-8 pubmed publisher
Zheng X, Carstens J, Kim J, Scheible M, Kaye J, Sugimoto H, et al. Epithelial-to-mesenchymal transition is dispensable for metastasis but induces chemoresistance in pancreatic cancer. Nature. 2015;527:525-530 pubmed publisher
Monaghan R, Barnes R, Fisher K, Andreou T, Rooney N, Poulin G, et al. A nuclear role for the respiratory enzyme CLK-1 in regulating mitochondrial stress responses and longevity. Nat Cell Biol. 2015;17:782-92 pubmed publisher
Jerlström Hultqvist J, Einarsson E, Xu F, Hjort K, Ek B, Steinhauf D, et al. Hydrogenosomes in the diplomonad Spironucleus salmonicida. Nat Commun. 2013;4:2493 pubmed publisher
Beckett K, Monier S, Palmer L, Alexandre C, Green H, Bonneil E, et al. Drosophila S2 cells secrete wingless on exosome-like vesicles but the wingless gradient forms independently of exosomes. Traffic. 2013;14:82-96 pubmed publisher
Jerlström Hultqvist J, Einarsson E, Svard S. Stable transfection of the diplomonad parasite Spironucleus salmonicida. Eukaryot Cell. 2012;11:1353-61 pubmed publisher
Idoyaga J, Cheong C, Suda K, Suda N, Kim J, Lee H, et al. Cutting edge: langerin/CD207 receptor on dendritic cells mediates efficient antigen presentation on MHC I and II products in vivo. J Immunol. 2008;180:3647-50 pubmed
Park S, Cheong C, Idoyaga J, Kim J, Choi J, Do Y, et al. Generation and application of new rat monoclonal antibodies against synthetic FLAG and OLLAS tags for improved immunodetection. J Immunol Methods. 2008;331:27-38 pubmed
product information
master code :
NBP1-82991
SKU :
NBP1-82991
product name :
ZEB2 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The ZEB2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ZEB2. This antibody reacts with human,mouse. The ZEB2 Antibody - BSA Free has been validated for the following applications: Chromatin Immunoprecipitation-exo-Seq,Immunohistochemistry,Western Blot,IF/IHC,Flow Cytometry,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence.
target :
ZEB2
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNI
KPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSS
EELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHN
SVSSSSE
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
ZEB2
Antibody validation :
Orthogonal Validation
applications :
Immunohistochemistry,Western Blot,IF/IHC,Flow Cytometry,Immunohistochemistry-Paraffin,Knockdown Validated,Immunocytochemistry/ Immunofluorescence
USD :
579 USD
alt names :
KIAA0569FLJ42816, SIP1HSPC082, Smad-interacting protein 1, SMADIP1ZFHX1BSIP-1, ZFX1B, zinc finger E-box binding homeobox 2, zinc finger E-box-binding homeobox 2, zinc finger homeobox 1b, Zinc finger homeobox protein 1b
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.