LRG1 Antibody - BSA Free | Novus Biologicals NBP1-82823 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

LRG1 Antibody - BSA Free

catalog :

NBP1-82823

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

MEM-25

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Aubert M, Yoon M, Sloan D, Spear P, Jerome K. The virological synapse facilitates herpes simplex virus entry into T cells. J Virol. 2009;83:6171-83 pubmed publisher
Wang J, Kwas C, Wu L. Intercellular adhesion molecule 1 (ICAM-1), but not ICAM-2 and -3, is important for dendritic cell-mediated human immunodeficiency virus type 1 transmission. J Virol. 2009;83:4195-204 pubmed publisher
Ottonello L, Epstein A, Mancini M, Dapino P, Dallegri F. Monoclonal LYM-1 antibody-dependent cytolysis by human neutrophils exposed to GM-CSF: auto-regulation of target cell attack by cathepsin G. J Leukoc Biol. 2004;75:99-105 pubmed
Mathison R, Befus A, Davison J, Woodman R. Modulation of neutrophil function by the tripeptide feG. BMC Immunol. 2003;4:3 pubmed
Hajishengallis G, Martin M, Sojar H, Sharma A, Schifferle R, DeNardin E, et al. Dependence of bacterial protein adhesins on toll-like receptors for proinflammatory cytokine induction. Clin Diagn Lab Immunol. 2002;9:403-11 pubmed
Garnotel R, Rittie L, Poitevin S, Monboisse J, Nguyen P, Potron G, et al. Human blood monocytes interact with type I collagen through alpha x beta 2 integrin (CD11c-CD18, gp150-95). J Immunol. 2000;164:5928-34 pubmed
Simon S, Cherapanov V, Nadra I, Waddell T, Seo S, Wang Q, et al. Signaling functions of L-selectin in neutrophils: alterations in the cytoskeleton and colocalization with CD18. J Immunol. 1999;163:2891-901 pubmed
Ottonello L, Epstein A, Dapino P, Barbera P, Morone P, Dallegri F. Monoclonal Lym-1 antibody-dependent cytolysis by neutrophils exposed to granulocyte-macrophage colony-stimulating factor: intervention of FcgammaRII (CD32), CD11b-CD18 integrins, and CD66b glycoproteins. Blood. 1999;93:3505-11 pubmed

product information

master code :

NBP1-82823

SKU :

NBP1-82823

product name :

LRG1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The LRG1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to LRG1. This antibody reacts with human,mouse. The LRG1 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

LRG1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAV
EFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRP
VPQLRVLDLTRNALTGLPPGLFQASATLDTLVLKENQLE
VLEVSWLHGLKALGHLDLSG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

LRG1

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

549 USD

alt names :

1300008B03Rik, 2310031E04Rik, HMFT1766, leucine-rich alpha-2-glycoprotein, leucine-rich alpha-2-glycoprotein 1, LRGleucine rich alpha 2 glycoprotein

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage