product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
LSECtin/CLEC4G Antibody - BSA Free
catalog :
NBP1-82815
quantity :
0.1 ml (also 25 ul)
price :
529 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunohistochemistry - paraffin section
more info or order :
image
image 1 :

product information
master code :
NBP1-82815
SKU :
NBP1-82815
product name :
LSECtin/CLEC4G Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The LSECtin/CLEC4G Antibody - BSA Free from Novus is a rabbit polyclonal antibody to LSECtin/CLEC4G. This antibody reacts with human. The LSECtin/CLEC4G Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin.
target :
LSECtin/CLEC4G
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
QGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSF
SHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWI
CEKR
This antibody was developed against Recombinant Protein corresponding to amino acids:
SHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWI
CEKR
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
CLEC4G
Antibody validation :
Orthogonal Validation
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin
USD :
529 USD
alt names :
C-type lectin domain family 4 member G, C-type lectin domain family 4, member G, C-type lectin superfamily 4, member G, DTTR431, liver and lymph node sinusoidal endothelial cell C-type lectin, LP2698, LSECtin, UNQ431
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
