MPST Antibody - BSA Free | Novus Biologicals NBP1-82617 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

MPST Antibody - BSA Free

catalog :

NBP1-82617

quantity :

0.1 ml

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 14

Reference
Huang S, Chen X, Pan J, Zhang H, Ke J, Gao L, et al. Hydrogen sulfide alleviates heart failure with preserved ejection fraction in mice by targeting mitochondrial abnormalities via PGC-1α. Nitric Oxide. 2023;136-137:12-23 pubmed publisher
Yilmaz Oral D, Kaya Sezginer E, Asker H, Gur S. Co-administration of sodium hydrosulfide and tadalafil modulates hypoxia and oxidative stress on bladder dysfunction in a rat model of bladder outlet obstruction. Int Braz J Urol. 2022;48:971-980 pubmed publisher
Wells G, Glasgow J, Nargan K, Lumamba K, Madansein R, Maharaj K, et al. Micro-Computed Tomography Analysis of the Human Tuberculous Lung Reveals Remarkable Heterogeneity in Three-dimensional Granuloma Morphology. Am J Respir Crit Care Med. 2021;204:583-595 pubmed publisher
Mellis A, Misko A, Arjune S, Liang Y, Erdélyi K, Ditrói T, et al. The role of glutamate oxaloacetate transaminases in sulfite biosynthesis and H2S metabolism. Redox Biol. 2021;38:101800 pubmed publisher
Qinyu Zeng -, Shuhua He -, Fengzhi Chen -, Li Wang -, Liren Zhong -, Jialiang Hui -, et al. Administration of H2S improves erectile dysfunction by inhibiting phenotypic modulation of corpus cavernosum smooth muscle in bilateral cavernous nerve injury rats. Nitric Oxide. 2021;107:1-10 pubmed publisher
Mitidieri E, Vanacore D, Turnaturi C, Sorrentino R, d Emmanuele di Villa Bianca R. Uterine Dysfunction in Diabetic Mice: The Role of Hydrogen Sulfide. Antioxidants (Basel). 2020;9: pubmed publisher
Jin Z, Zhang Q, Wondimu E, Verma R, Fu M, Shuang T, et al. H2S-stimulated bioenergetics in chicken erythrocytes and the underlying mechanism. Am J Physiol Regul Integr Comp Physiol. 2020;319:R69-R78 pubmed publisher
Zhong L, Ding W, Zeng Q, He B, Zhang H, Wang L, et al. Sodium Tanshinone IIA Sulfonate Attenuates Erectile Dysfunction in Rats with Hyperlipidemia. Oxid Med Cell Longev. 2020;2020:7286958 pubmed publisher
Nasi S, Ehirchiou D, Chatzianastasiou A, Nagahara N, Papapetropoulos A, Bertrand J, et al. The protective role of the 3-mercaptopyruvate sulfurtransferase (3-MST)-hydrogen sulfide (H2S) pathway against experimental osteoarthritis. Arthritis Res Ther. 2020;22:49 pubmed publisher
Rahman M, Cumming B, Addicott K, Pacl H, Russell S, Nargan K, et al. Hydrogen sulfide dysregulates the immune response by suppressing central carbon metabolism to promote tuberculosis. Proc Natl Acad Sci U S A. 2020;117:6663-6674 pubmed publisher
Yao Y, Xu X, Yang L, Zhu J, Wan J, Shen L, et al. Patient-Derived Organoids Predict Chemoradiation Responses of Locally Advanced Rectal Cancer. Cell Stem Cell. 2020;26:17-26.e6 pubmed publisher
Sandberg T, Sweere I, van Pelt G, Putter H, Vermeulen L, Kuppen P, et al. Prognostic value of low CDX2 expression in colorectal cancers with a high stromal content - a short report. Cell Oncol (Dordr). 2019;42:397-403 pubmed publisher
Yetik Anacak G, Dikmen A, Coletta C, Mitidieri E, Dereli M, Donnarumma E, et al. Hydrogen sulfide compensates nitric oxide deficiency in murine corpus cavernosum. Pharmacol Res. 2016;113:38-43 pubmed publisher
Trinh A, Trumpi K, De Sousa E Melo F, Wang X, de Jong J, Fessler E, et al. Practical and Robust Identification of Molecular Subtypes in Colorectal Cancer by Immunohistochemistry. Clin Cancer Res. 2017;23:387-398 pubmed publisher

product information

master code :

NBP1-82617

SKU :

NBP1-82617

product name :

MPST Antibody - BSA Free

unit size :

0.1 ml

description :

The MPST Antibody - BSA Free from Novus is a rabbit polyclonal antibody to MPST. This antibody reacts with human,mouse,rat. The MPST Antibody - BSA Free has been validated for the following applications: Western Blot,IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western,Immunocytochemistry/ Immunofluorescence.

target :

MPST

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

AVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAF
IKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIE
PGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDL
SKPLVATCGSGVTACHVALGAYLCGKPD
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

theoretical molecular weight :

33 kDa

gene symbol :

MPST

Antibody validation :

Orthogonal Validation

accessionNumbers :

P25325

applications :

Western Blot,IF/IHC,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western,Immunocytochemistry/ Immunofluorescence

USD :

559 USD

alt names :

mercaptopyruvate sulfurtransferase, MGC24539, MSThuman liver rhodanese, TST2EC 2.8.1.2,3-mercaptopyruvate sulfurtransferase

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage