product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
NHE3/SLC9A3 Antibody - BSA Free
catalog :
NBP1-82574
quantity :
0.1 ml (also 25 ul)
price :
559 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
HTA125
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section
more info or order :
citations: 55
Published Application/Species/Sample/DilutionReference
  • immunohistochemistry - frozen section; mouse; loading ...; fig 3c, 7d
Yue R, Wei X, Zhao J, Zhou Z, Zhong W. Essential Role of IFN-γ in Regulating Gut Antimicrobial Peptides and Microbiota to Protect Against Alcohol-Induced Bacterial Translocation and Hepatic Inflammation in Mice. Front Physiol. 2020;11:629141 pubmed publisher
  • immunohistochemistry - paraffin section; mouse; 1:100; loading ...; fig 6a
Pinette J, Mao S, Millis B, Krystofiak E, Faust J, Tyska M. Brush border protocadherin CDHR2 promotes the elongation and maximized packing of microvilli in vivo. Mol Biol Cell. 2019;30:108-118 pubmed publisher
Amiri M, Jiang M, Salari A, Xiu R, Alper S, Seidler U. Reduced surface pH and upregulated AE2 anion exchange in SLC26A3-deleted polarized intestinal epithelial cells. Am J Physiol Cell Physiol. 2024;: pubmed publisher
Kim Y, Lee Y, Park S, Park S, Eom S, Lee Y, et al. Mid-old cells are a potential target for anti-aging interventions in the elderly. Nat Commun. 2023;14:7619 pubmed publisher
Yue R, Wei X, Hao L, Dong H, Guo W, Sun X, et al. Promoting intestinal antimicrobial defense and microbiome symbiosis contributes to IL-22-mediated protection against alcoholic hepatitis in mice. Front Immunol. 2023;14:1289356 pubmed publisher
M xf6 dl B, Awad M, Zwolanek D, Scharf I, Schwertner K, Milovanovic D, et al. Defects in microvillus crosslinking sensitize to colitis and inflammatory bowel disease. EMBO Rep. 2023;24:e57084 pubmed publisher
Kunke M, Kn xf6 fler H, Dahlke E, Zanon Rodríguez L, B xf6 ttner M, Larionov A, et al. Targeted deletion of von-Hippel-Lindau in the proximal tubule conditions the kidney against early diabetic kidney disease. Cell Death Dis. 2023;14:562 pubmed publisher
Zachos N, Vaughan H, Sarker R, Est Witte S, Chakraborty M, Baetz N, et al. A Novel Peptide Prevents Enterotoxin- and Inflammation-Induced Intestinal Fluid Secretion by Stimulating Sodium-Hydrogen Exchanger 3 Activity. Gastroenterology. 2023;165:986-998.e11 pubmed publisher
Peritore Galve F, Kaji I, Smith A, Walker L, Shupe J, Washington M, et al. Increased intestinal permeability and downregulation of absorptive ion transporters Nhe3, Dra, and Sglt1 contribute to diarrhea during Clostridioides difficile infection. Gut Microbes. 2023;15:2225841 pubmed publisher
Salari A, Zhou K, Nikolovska K, Seidler U, Amiri M. Human Colonoid-Myofibroblast Coculture for Study of Apical Na+/H+ Exchangers of the Lower Cryptal Neck Region. Int J Mol Sci. 2023;24: pubmed publisher
Donowitz M, Sarker R, Lin R, McNamara G, Tse C, Singh V. Identification of Intestinal NaCl Absorptive-Anion Secretory Cells: Potential Functional Significance. Front Physiol. 2022;13:892112 pubmed publisher
Duclaux Loras R, Lebreton C, Berthelet J, Charbit Henrion F, Nicolle O, Revenu de Courtils C, et al. UNC45A deficiency causes microvillus inclusion disease-like phenotype by impairing myosin VB-dependent apical trafficking. J Clin Invest. 2022;132: pubmed publisher
Haynes J, Palaniappan B, Tsopmegha E, Sundaram U. Regulation of nutrient and electrolyte absorption in human organoid-derived intestinal epithelial cell monolayers. Transl Res. 2022;248:22-35 pubmed publisher
Hiltz R, McCurdy D, Moreland S, Klanderman K, Laarman A. Effects of weaning on regulators of volatile fatty acid absorption and intracellular pH in Holstein calves. JDS Commun. 2021;2:324-328 pubmed publisher
Yanda M, Cebotaru L. VX-809 mitigates disease in a mouse model of autosomal dominant polycystic kidney disease bearing the R3277C human mutation. FASEB J. 2021;35:e21987 pubmed publisher
Zhou K, Amiri M, Salari A, Yu Y, Xu H, Seidler U, et al. Functional characterization of the sodium/hydrogen exchanger 8 and its role in proliferation of colonic epithelial cells. Am J Physiol Cell Physiol. 2021;321:C471-C488 pubmed publisher
Zhang J, Huang Y, Yoon J, Kemmitt J, Wright C, Schneider K, et al. Primary human colonic mucosal barrier crosstalk with super oxygen-sensitive Faecalibacterium prausnitzii in continuous culture. Med (N Y). 2021;2:74-98.e9 pubmed publisher
Yin J, Sunuwar L, Kasendra M, Yu H, Tse C, Talbot C, et al. Fluid Shear Stress Enhances Differentiation of Jejunal Human Enteroids in Intestine-Chip. Am J Physiol Gastrointest Liver Physiol. 2020;: pubmed publisher
Klinger S. Segment-specific effects of resveratrol on porcine small intestinal dipeptide absorption depend on the mucosal pH and are due to different mechanisms: potential roles of different transport proteins and protein kinases. J Nutr Biochem. 2020;85:108467 pubmed publisher
Hernandez Gordillo V, Kassis T, Lampejo A, Choi G, Gamboa M, Gnecco J, et al. Fully synthetic matrices for in vitro culture of primary human intestinal enteroids and endometrial organoids. Biomaterials. 2020;254:120125 pubmed publisher
The E, Yao Q, Zhang P, Zhai Y, Ao L, Fullerton D, et al. Mechanistic Roles of Matrilin-2 and Klotho in Modulating the Inflammatory Activity of Human Aortic Valve Cells. Cells. 2020;9: pubmed publisher
Ji X, Zhang X, Li H, Sun L, Hou X, Song H, et al. Nfa34810 Facilitates Nocardia farcinica Invasion of Host Cells and Stimulates Tumor Necrosis Factor Alpha Secretion through Activation of the NF-κB and Mitogen-Activated Protein Kinase Pathways via Toll-Like Receptor 4. Infect Immun. 2020;88: pubmed publisher
Chen T, Lin R, Avula L, Sarker R, Yang J, Cha B, et al. NHERF3 is necessary for Escherichia coli heat-stable enterotoxin-induced inhibition of NHE3: differences in signaling in mouse small intestine and Caco-2 cells. Am J Physiol Cell Physiol. 2019;317:C737-C748 pubmed publisher
Engevik A, Kaji I, Engevik M, Meyer A, Weis V, Goldstein A, et al. Loss of MYO5B Leads to Reductions in Na+ Absorption With Maintenance of CFTR-Dependent Cl- Secretion in Enterocytes. Gastroenterology. 2018;155:1883-1897.e10 pubmed publisher
Schlegel C, Lapierre L, Weis V, Williams J, Kaji I, Pinzon Guzman C, et al. Reversible deficits in apical transporter trafficking associated with deficiency in diacylglycerol acyltransferase. Traffic. 2018;19:879-892 pubmed publisher
Singh V, Yang J, Yin J, Cole R, Tse M, Berman D, et al. Cholera toxin inhibits SNX27-retromer-mediated delivery of cargo proteins to the plasma membrane. J Cell Sci. 2018;131: pubmed publisher
Yin J, Tse C, Avula L, Singh V, Foulke Abel J, de Jonge H, et al. Molecular Basis and Differentiation-Associated Alterations of Anion Secretion in Human Duodenal Enteroid Monolayers. Cell Mol Gastroenterol Hepatol. 2018;5:591-609 pubmed publisher
Rajkumar P, Cha B, Yin J, Arend L, Paunescu T, Hirabayashi Y, et al. Identifying the localization and exploring a functional role for Gprc5c in the kidney. FASEB J. 2018;32:2046-2059 pubmed publisher
Li F, Song R, Ao L, Reece T, Cleveland J, Dong N, et al. ADAMTS5 Deficiency in Calcified Aortic Valves Is Associated With Elevated Pro-Osteogenic Activity in Valvular Interstitial Cells. Arterioscler Thromb Vasc Biol. 2017;37:1339-1351 pubmed publisher
Yin J, Tse C, Cha B, Sarker R, Zhu X, Walentinsson A, et al. A common NHE3 single-nucleotide polymorphism has normal function and sensitivity to regulatory ligands. Am J Physiol Gastrointest Liver Physiol. 2017;313:G129-G137 pubmed publisher
Zeng Q, Song R, Fullerton D, Ao L, Zhai Y, Li S, et al. Interleukin-37 suppresses the osteogenic responses of human aortic valve interstitial cells in vitro and alleviates valve lesions in mice. Proc Natl Acad Sci U S A. 2017;114:1631-1636 pubmed publisher
Foulke Abel J, In J, Yin J, Zachos N, Kovbasnjuk O, Estes M, et al. Human Enteroids as a Model of Upper Small Intestinal Ion Transport Physiology and Pathophysiology. Gastroenterology. 2016;150:638-649.e8 pubmed publisher
Engevik M, Engevik K, Yacyshyn M, Wang J, Hassett D, Darien B, et al. Human Clostridium difficile infection: inhibition of NHE3 and microbiota profile. Am J Physiol Gastrointest Liver Physiol. 2015;308:G497-509 pubmed publisher
Käbisch R, Mejías Luque R, Gerhard M, Prinz C. Involvement of Toll-like receptors on Helicobacter pylori-induced immunity. PLoS ONE. 2014;9:e104804 pubmed publisher
Rojas Bernabé A, Garcia Hernández O, Maldonado Bernal C, Delegado Dominguez J, Ortega E, Gutiérrez Kobeh L, et al. Leishmania mexicana lipophosphoglycan activates ERK and p38 MAP kinase and induces production of proinflammatory cytokines in human macrophages through TLR2 and TLR4. Parasitology. 2014;141:788-800 pubmed publisher
Harman A, Bye C, Nasr N, Sandgren K, Kim M, Mercier S, et al. Identification of lineage relationships and novel markers of blood and skin human dendritic cells. J Immunol. 2013;190:66-79 pubmed publisher
Matsunaga N, Tsuchimori N, Matsumoto T, Ii M. TAK-242 (resatorvid), a small-molecule inhibitor of Toll-like receptor (TLR) 4 signaling, binds selectively to TLR4 and interferes with interactions between TLR4 and its adaptor molecules. Mol Pharmacol. 2011;79:34-41 pubmed publisher
Pillay J, Ramakers B, Kamp V, Loi A, Lam S, Hietbrink F, et al. Functional heterogeneity and differential priming of circulating neutrophils in human experimental endotoxemia. J Leukoc Biol. 2010;88:211-20 pubmed publisher
Wu C, Chi P, Hsieh H, Luo S, Yang C. TLR4-dependent induction of vascular adhesion molecule-1 in rheumatoid arthritis synovial fibroblasts: Roles of cytosolic phospholipase A(2)alpha/cyclooxygenase-2. J Cell Physiol. 2010;223:480-91 pubmed publisher
Pietschmann K, Beetz S, Welte S, Martens I, Gruen J, Oberg H, et al. Toll-like receptor expression and function in subsets of human gammadelta T lymphocytes. Scand J Immunol. 2009;70:245-55 pubmed publisher
O Hara S, Small A, Gajdos G, Badley A, Chen X, Larusso N. HIV-1 Tat protein suppresses cholangiocyte toll-like receptor 4 expression and defense against Cryptosporidium parvum. J Infect Dis. 2009;199:1195-204 pubmed publisher
Hammadi A, Billard C, Faussat A, Kolb J. Stimulation of iNOS expression and apoptosis resistance in B-cell chronic lymphocytic leukemia (B-CLL) cells through engagement of Toll-like receptor 7 (TLR-7) and NF-kappaB activation. Nitric Oxide. 2008;19:138-45 pubmed publisher
Burgener I, Jungi T. Antibodies specific for human or murine Toll-like receptors detect canine leukocytes by flow cytometry. Vet Immunol Immunopathol. 2008;124:184-91 pubmed publisher
Prabha C, Rajashree P, Sulochana D. TLR2 and TLR4 expression on the immune cells of tuberculous pleural fluid. Immunol Lett. 2008;117:26-34 pubmed publisher
Pegu A, Qin S, Fallert Junecko B, Nisato R, Pepper M, Reinhart T. Human lymphatic endothelial cells express multiple functional TLRs. J Immunol. 2008;180:3399-405 pubmed
Murciano C, Villamon E, Yáñez A, Murciano J, Mir A, O Connor J, et al. In vitro response to Candida albicans in cultures of whole human blood from young and aged donors. FEMS Immunol Med Microbiol. 2007;51:327-35 pubmed
Wong C, Cheung P, Ip W, Lam C. Intracellular signaling mechanisms regulating toll-like receptor-mediated activation of eosinophils. Am J Respir Cell Mol Biol. 2007;37:85-96 pubmed
Basu S, Pathak S, Banerjee A, Pathak S, Bhattacharyya A, Yang Z, et al. Execution of macrophage apoptosis by PE_PGRS33 of Mycobacterium tuberculosis is mediated by Toll-like receptor 2-dependent release of tumor necrosis factor-alpha. J Biol Chem. 2007;282:1039-50 pubmed
Shahrara S, Park C, Temkin V, Jarvis J, Volin M, Pope R. RANTES modulates TLR4-induced cytokine secretion in human peripheral blood monocytes. J Immunol. 2006;177:5077-87 pubmed
Scheel O, Papavlassopoulos M, Blunck R, Gebert A, Hartung T, Zahringer U, et al. Cell activation by ligands of the toll-like receptor and interleukin-1 receptor family depends on the function of the large-conductance potassium channel MaxiK in human macrophages. Infect Immun. 2006;74:4354-6 pubmed
Konno K, Wakabayashi Y, Akashi Takamura S, Ishii T, Kobayashi M, Takahashi K, et al. A molecule that is associated with Toll-like receptor 4 and regulates its cell surface expression. Biochem Biophys Res Commun. 2006;339:1076-82 pubmed
Cognasse F, Hamzeh H, Chavarin P, Acquart S, Genin C, Garraud O. Evidence of Toll-like receptor molecules on human platelets. Immunol Cell Biol. 2005;83:196-8 pubmed
Basak C, Pathak S, Bhattacharyya A, Mandal D, Pathak S, Kundu M. NF-kappaB- and C/EBPbeta-driven interleukin-1beta gene expression and PAK1-mediated caspase-1 activation play essential roles in interleukin-1beta release from Helicobacter pylori lipopolysaccharide-stimulated macrophages. J Biol Chem. 2005;280:4279-88 pubmed
Mempel M, Voelcker V, Köllisch G, Plank C, Rad R, Gerhard M, et al. Toll-like receptor expression in human keratinocytes: nuclear factor kappaB controlled gene activation by Staphylococcus aureus is toll-like receptor 2 but not toll-like receptor 4 or platelet activating factor receptor dependent. J Invest Dermatol. 2003;121:1389-96 pubmed
Lotz S, Aga E, Wilde I, van Zandbergen G, Hartung T, Solbach W, et al. Highly purified lipoteichoic acid activates neutrophil granulocytes and delays their spontaneous apoptosis via CD14 and TLR2. J Leukoc Biol. 2004;75:467-77 pubmed
product information
master code :
NBP1-82574
SKU :
NBP1-82574
product name :
NHE3/SLC9A3 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The NHE3/SLC9A3 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to NHE3/SLC9A3. This antibody reacts with human,mouse,porcine. The NHE3/SLC9A3 Antibody - BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,IF/IHC,SDS-Page,Flow Cytometry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunohistochemistry.
target :
NHE3/SLC9A3
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
DNPVFSPDEALDRSLLARLPPWLSPGETVVPSQRARTQI
PYSPGTFCRLMPFRLSSKSVDSFLQADGPEERPPAALPE
ST
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Porcine
gene symbol :
SLC9A3
Antibody validation :
Independent Anitbodies
applications :
Immunocytochemistry/ Immunofluorescence,IF/IHC,SDS-Page,Flow Cytometry,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunohistochemistry
USD :
559 USD
alt names :
isoform 3, MGC126718, NHE3MGC126720, solute carrier family 9 (sodium/hydrogen exchanger), member 3, Solute carrier family 9 member 3
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.