UBTF Antibody - BSA Free | Novus Biologicals NBP1-82545 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

UBTF Antibody - BSA Free

catalog :

NBP1-82545

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 11

Reference
Potapova T, Unruh J, Conkright Fincham J, Banks C, Florens L, SCHNEIDER D, et al. Distinct states of nucleolar stress induced by anticancer drugs. elife. 2023;12: pubmed publisher
Sturiale V, Bruno F, Brancato D, D Amico A, Maugeri G, D Agata V, et al. Cell Cycle Reactivation, at the Start of Neurodegeneration, Induced by Forskolin and Aniline in Differentiated Neuroblastoma Cells. Int J Mol Sci. 2023;24: pubmed publisher
Jaberi Lashkari N, Lee B, Aryan F, Calo E. An evolutionarily nascent architecture underlying the formation and emergence of biomolecular condensates. Cell Rep. 2023;42:112955 pubmed publisher
Yang X, Wang X, Hu L, Feng M, Zhou Y, Li D, et al. Nucleolar HEAT Repeat Containing 1 Up-regulated by the Mechanistic Target of Rapamycin Complex 1 Signaling Promotes Hepatocellular Carcinoma Growth by Dominating Ribosome Biogenesis and Proteome Homeostasis. Gastroenterology. 2023;165:629-646 pubmed publisher
Lee B, Jaberi Lashkari N, Calo E. A unified view of low complexity regions (LCRs) across species. elife. 2022;11: pubmed publisher
Venegas A, Natsume T, Kanemaki M, Hickson I. Inducible Degradation of the Human SMC5/6 Complex Reveals an Essential Role Only during Interphase. Cell Rep. 2020;31:107533 pubmed publisher
Felipe Abrio B, Verdugo Sivianes E, Saez C, Carnero A. Loss of MYBBP1A Induces Cancer Stem Cell Activity in Renal Cancer. Cancers (Basel). 2019;11: pubmed publisher
Maiti A, Sharba S, Navabi N, Linden S. Colonic levels of vasoactive intestinal peptide decrease during infection and exogenous VIP protects epithelial mitochondria against the negative effects of IFNγ and TNFα induced during Citrobacter rodentium infection. PLoS ONE. 2018;13:e0204567 pubmed publisher
Chishiki M, Takagi K, Sato A, Miki Y, Yamamoto Y, Ebata A, et al. Cytochrome c1 in ductal carcinoma in situ of breast associated with proliferation and comedo necrosis. Cancer Sci. 2017;108:1510-1519 pubmed publisher
Maiti A, Sharba S, Navabi N, Forsman H, Fernandez H, Linden S. IL-4 Protects the Mitochondria Against TNFα and IFNγ Induced Insult During Clearance of Infection with Citrobacter rodentium and Escherichia coli. Sci Rep. 2015;5:15434 pubmed publisher
Desmurs M, Foti M, Raemy E, Vaz F, Martinou J, Bairoch A, et al. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Mol Cell Biol. 2015;35:1139-56 pubmed publisher

product information

master code :

NBP1-82545

SKU :

NBP1-82545

product name :

UBTF Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The UBTF Antibody - BSA Free from Novus is a rabbit polyclonal antibody to UBTF. This antibody reacts with human,mouse. The UBTF Antibody - BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Knockdown Validated.

target :

UBTF

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQ
QRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKR
PVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDL
SEKKK
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

UBTF

Antibody validation :

Knockout/Knockdown

applications :

Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin,Knockdown Validated

USD :

559 USD

alt names :

90-KDa Nucleolus Organizer Region Autoantigen, Autoantigen NOR-90, NOR-90, nucleolar transcription factor 1, UBF, UBF1, UBF-1, UBF2, UBFUBF-1, upstream binding transcription factor, RNA polymerase I, Upstream-binding factor 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage