ALKBH5 Antibody - BSA Free | Novus Biologicals NBP1-82188 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ALKBH5 Antibody - BSA Free

catalog :

NBP1-82188

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Cie x15b la M, Ngoc P, Muthukumar S, Todisco G, Madej M, Fritz H, et al. m6A-driven SF3B1 translation control steers splicing to direct genome integrity and leukemogenesis. Mol Cell. 2023;83:1165-1179.e11 pubmed publisher
Hesser C, Walsh D. YTHDF2 Is Downregulated in Response to Host Shutoff Induced by DNA Virus Infection and Regulates Interferon-Stimulated Gene Expression. J Virol. 2023;97:e0175822 pubmed publisher
Su X, Shen Y, Jin Y, Kim I, Weintraub N, Tang Y. Aging-Associated Differences in Epitranscriptomic m6A Regulation in Response to Acute Cardiac Ischemia/Reperfusion Injury in Female Mice. Front Pharmacol. 2021;12:654316 pubmed publisher
Querido E, Sfeir A, Chartrand P. Imaging of Telomerase RNA by Single-Molecule Inexpensive FISH Combined with Immunofluorescence. STAR Protoc. 2020;1:100104 pubmed publisher
Jiang Y, Wan Y, Gong M, Zhou S, Qiu J, Cheng W. RNA demethylase ALKBH5 promotes ovarian carcinogenesis in a simulated tumour microenvironment through stimulating NF-κB pathway. J Cell Mol Med. 2020;24:6137-6148 pubmed publisher
Li X, Jin F, Wang B, Yin X, Hong W, Tian F. The m6A demethylase ALKBH5 controls trophoblast invasion at the maternal-fetal interface by regulating the stability of CYR61 mRNA. Theranostics. 2019;9:3853-3865 pubmed publisher
Zhang C, Zhi W, Lu H, Samanta D, Chen I, Gabrielson E, et al. Hypoxia-inducible factors regulate pluripotency factor expression by ZNF217- and ALKBH5-mediated modulation of RNA methylation in breast cancer cells. Oncotarget. 2016;7:64527-64542 pubmed publisher
Zhang C, Samanta D, Lu H, Bullen J, Zhang H, Chen I, et al. Hypoxia induces the breast cancer stem cell phenotype by HIF-dependent and ALKBH5-mediated m?A-demethylation of NANOG mRNA. Proc Natl Acad Sci U S A. 2016;113:E2047-56 pubmed publisher

product information

master code :

NBP1-82188

SKU :

NBP1-82188

product name :

ALKBH5 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The ALKBH5 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ALKBH5. This antibody reacts with human,mouse. The ALKBH5 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Knockdown Validated.

target :

ALKBH5

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

EKLKSMTSRDNYKAGSREAAAAAAAAVAAAAAAAAAAEP
YPVSGAKRKYQEDSDPERSDYEEQQLQKEEEARKVKSGI
RQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVD
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

theoretical molecular weight :

51 kDa

gene symbol :

ALKBH5

Antibody validation :

Knockout/Knockdown

accessionNumbers :

Q6P6C2

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Knockdown Validated

USD :

549 USD

alt names :

ABH5OFOXD, alkB, alkylation repair homolog 5 (E. coli), Alkylated DNA repair protein alkB homolog 5, EC 1.14.11.-, FLJ20308, OFOXD1, oxoglutarate and iron-dependent oxygenase domain containing, probable alpha-ketoglutarate-dependent dioxygenase ABH5

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage