NPLOC4 Antibody - BSA Free | Novus Biologicals NBP1-82166 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

NPLOC4 Antibody - BSA Free

catalog :

NBP1-82166

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Kanellis D, Zisi A, Skrott Z, Lemmens B, Espinoza J, Kosar M, et al. Actionable cancer vulnerability due to translational arrest, p53 aggregation and ribosome biogenesis stress evoked by the disulfiram metabolite CuET. Cell Death Differ. 2023;30:1666-1678 pubmed publisher
Chroma K, Skrott Z, Gursky J, Bacovsky J, Moudry P, Buchtova T, et al. A drug repurposing strategy for overcoming human multiple myeloma resistance to standard-of-care treatment. Cell Death Dis. 2022;13:203 pubmed publisher
Buchtova T, Skrott Z, Chroma K, Rehulka J, Dzubak P, Hajduch M, et al. Cannabidiol-induced activation of the metallothionein pathway impedes anticancer effects of disulfiram and its metabolite CuET. Mol Oncol. 2022;16:1541-1554 pubmed publisher
Serra R, Zhao T, Huq S, Gorelick N, Casaos J, Cecia A, et al. Disulfiram and copper combination therapy targets NPL4, cancer stem cells and extends survival in a medulloblastoma model. PLoS ONE. 2021;16:e0251957 pubmed publisher
Franz A, Valledor P, Ubieto Capella P, Pilger D, Galarreta A, Lafarga V, et al. USP7 and VCPFAF1 define the SUMO/Ubiquitin landscape at the DNA replication fork. Cell Rep. 2021;37:109819 pubmed publisher
Neglia L, Oggioni M, Mercurio D, De Simoni M, Fumagalli S. Specific contribution of mannose-binding lectin murine isoforms to brain ischemia/reperfusion injury. Cell Mol Immunol. 2019;: pubmed publisher
Skrott Z, Mistrik M, Andersen K, Friis S, Majera D, Gursky J, et al. Alcohol-abuse drug disulfiram targets cancer via p97 segregase adaptor NPL4. Nature. 2017;552:194-199 pubmed publisher

product information

master code :

NBP1-82166

SKU :

NBP1-82166

product name :

NPLOC4 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The NPLOC4 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to NPLOC4. This antibody reacts with human,mouse,rat. The NPLOC4 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry.

target :

NPLOC4

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFG
NEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFP
IENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLL
FLVTNE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

NPLOC4

Antibody validation :

Independent Anitbodies

applications :

Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry

USD :

559 USD

alt names :

FLJ20657, FLJ23742, KIAA1499nuclear protein localization protein 4 homolog, NPL4Protein NPL4, nuclear protein localization 4 homolog (S. cerevisiae)

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage