LONP1 Antibody - BSA Free | Novus Biologicals NBP1-81734 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

LONP1 Antibody - BSA Free

catalog :

NBP1-81734

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 18

Reference
Sekine Y, Houston R, Eckl E, Fessler E, Narendra D, Jae L, et al. A mitochondrial iron-responsive pathway regulated by DELE1. Mol Cell. 2023;83:2059-2076.e6 pubmed publisher
Lane S, Parks J, Russ J, Khan S, Schoolcraft W, Yuan Y, et al. Increased Systemic Antioxidant Power Ameliorates the Aging-Related Reduction in Oocyte Competence in Mice. Int J Mol Sci. 2021;22: pubmed publisher
Di Rienzo M, Romagnoli A, Ciccosanti F, Refolo G, Consalvi V, Arena G, et al. AMBRA1 regulates mitophagy by interacting with ATAD3A and promoting PINK1 stability. Autophagy. 2021;:1-11 pubmed publisher
Houston R, Sekine Y, Larsen M, Murakami K, Mullett S, Wendell S, et al. Discovery of bactericides as an acute mitochondrial membrane damage inducer. Mol Biol Cell. 2021;32:ar32 pubmed publisher
Burska D, Stiburek L, Krizova J, Vanisova M, Martinek V, Sladkova J, et al. Homozygous missense mutation in UQCRC2 associated with severe encephalomyopathy, mitochondrial complex III assembly defect and activation of mitochondrial protein quality control. Biochim Biophys Acta Mol Basis Dis. 2021;1867:166147 pubmed publisher
Lee Y, Kim H, Nam Y, Shin K, Lee Y, Park D, et al. LONP1 and ClpP cooperatively regulate mitochondrial proteostasis for cancer cell survival. Oncogenesis. 2021;10:18 pubmed publisher
Pareek G, Pallanck L. Inactivation of the mitochondrial protease Afg3l2 results in severely diminished respiratory chain activity and widespread defects in mitochondrial gene expression. PLoS Genet. 2020;16:e1009118 pubmed publisher
Xie J, Yuan S, Peng L, Li H, Niu L, Xu H, et al. Antitumor immunity targeting fibroblast activation protein-α in a mouse Lewis lung carcinoma model. Oncol Lett. 2020;20:868-876 pubmed publisher
Miyadera K, Conatser L, Llanga T, Carlin K, O Donnell P, Bagel J, et al. Intrastromal Gene Therapy Prevents and Reverses Advanced Corneal Clouding in a Canine Model of Mucopolysaccharidosis I. Mol Ther. 2020;28:1455-1463 pubmed publisher
Hong E, Park S, Ooshima A, Hong C, Park J, Heo J, et al. Inhibition of TGF-β signalling in combination with nal-IRI plus 5-Fluorouracil/Leucovorin suppresses invasion and prolongs survival in pancreatic tumour mouse models. Sci Rep. 2020;10:2935 pubmed publisher
Ishikawa K, Kobayashi K, Yamada A, Umehara M, Oka T, Nakada K. Concentration of mitochondrial DNA mutations by cytoplasmic transfer from platelets to cultured mouse cells. PLoS ONE. 2019;14:e0213283 pubmed publisher
Sekine S, Wang C, Sideris D, Bunker E, Zhang Z, Youle R. Reciprocal Roles of Tom7 and OMA1 during Mitochondrial Import and Activation of PINK1. Mol Cell. 2019;73:1028-1043.e5 pubmed publisher
Pareek G, Thomas R, Vincow E, Morris D, Pallanck L. Lon protease inactivation in Drosophila causes unfolded protein stress and inhibition of mitochondrial translation. Cell Death Discov. 2018;4:51 pubmed publisher
Gai Z, Visentin M, Gui T, Zhao L, Thasler W, Häusler S, et al. Effects of Farnesoid X Receptor Activation on Arachidonic Acid Metabolism, NF-kB Signaling, and Hepatic Inflammation. Mol Pharmacol. 2018;94:802-811 pubmed publisher
Pareek G, Thomas R, Pallanck L. Loss of the Drosophila m-AAA mitochondrial protease paraplegin results in mitochondrial dysfunction, shortened lifespan, and neuronal and muscular degeneration. Cell Death Dis. 2018;9:304 pubmed publisher
Boutoual R, Meseguer S, Villarroya M, Martin Hernandez E, Errami M, Martin M, et al. Defects in the mitochondrial-tRNA modification enzymes MTO1 and GTPBP3 promote different metabolic reprogramming through a HIF-PPARγ-UCP2-AMPK axis. Sci Rep. 2018;8:1163 pubmed publisher
Gai Z, Chu L, Xu Z, Song X, Sun D, Kullak Ublick G. Farnesoid X receptor activation protects the kidney from ischemia-reperfusion damage. Sci Rep. 2017;7:9815 pubmed publisher
Meseguer S, Boix O, Navarro González C, Villarroya M, Boutoual R, Emperador S, et al. microRNA-mediated differential expression of TRMU, GTPBP3 and MTO1 in cell models of mitochondrial-DNA diseases. Sci Rep. 2017;7:6209 pubmed publisher

product information

master code :

NBP1-81734

SKU :

NBP1-81734

product name :

LONP1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The LONP1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to LONP1. This antibody reacts with drosophila,human,insect - drosophila,mouse,rat. The LONP1 Antibody - BSA Free has been validated for the following applications: Western Blot,Simple Western,Immunocytochemistry/ Immunofluorescence,Knockdown Validated,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

LONP1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKF
RERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRN
YLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKK
RILEFIAVSQLRGSTQGKILCFYGP
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Drosophila,Human,Insect - Drosophila,Mouse,Rat

gene symbol :

LONP1

Antibody validation :

Knockout/Knockdown

applications :

Western Blot,Simple Western,Immunocytochemistry/ Immunofluorescence,Knockdown Validated,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

EC 3.4.21, EC 3.4.21.-, EC 3.4.21.53, hLON, hLON ATP-dependent protease, LON, lon peptidase 1, mitochondrial, lon protease homolog, mitochondrial, Lon protease-like protein, LONHs, LONP, Mitochondrial ATP-dependent protease Lon, mitochondrial lon peptidase 1, mitochondrial lon protease-like protein, PIM1, protease, serine, 15, PRSS15MGC1498, Serine protease 15

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage