product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
TOMM20 Antibody - BSA Free
catalog :
NBP1-81556
quantity :
0.1 ml (also 25 ul)
price :
569 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
XVIF9-G10
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 22
| Reference |
|---|
Liu W, Luque M, Glueckert R, Danckwardt Lillieström N, Nordström C, Schrott Fischer A, et al. Expression of Na/K-ATPase subunits in the human cochlea: a confocal and super-resolution microscopy study with special reference to auditory nerve excitation and cochlear implantation. Ups J Med Sci. 2019;124:168-179 pubmed publisher
|
Molday L, Wu W, Molday R. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. J Biol Chem. 2007;282:32792-801 pubmed
|
Ferguson S, Savchenko V, Apparsundaram S, Zwick M, Wright J, Heilman C, et al. Vesicular localization and activity-dependent trafficking of presynaptic choline transporters. J Neurosci. 2003;23:9697-709 pubmed
|
Hoffman J, Wickrema A, Potapova O, Milanick M, Yingst D. Na pump isoforms in human erythroid progenitor cells and mature erythrocytes. Proc Natl Acad Sci U S A. 2002;99:14572-7 pubmed
|
Brickley D, Mikosz C, Hagan C, Conzen S. Ubiquitin modification of serum and glucocorticoid-induced protein kinase-1 (SGK-1). J Biol Chem. 2002;277:43064-70 pubmed
|
Kong J, Meng J, Biser P, Fleming W, Taylor D. Cellular depolarization of neurons in the locus ceruleus region of the guinea pig associated with the development of tolerance to opioids. J Pharmacol Exp Ther. 2001;298:909-16 pubmed
|
Wetzel R, Sweadner K. Immunocytochemical localization of NaK-ATPase isoforms in the rat and mouse ocular ciliary epithelium. Invest Ophthalmol Vis Sci. 2001;42:763-9 pubmed
|
Tao Q, Hollenberg N, Graves S. Sodium pump inhibition and regional expression of sodium pump alpha-isoforms in lens. Hypertension. 1999;34:1168-74 pubmed
|
product information
master code :
NBP1-81556
SKU :
NBP1-81556
product name :
TOMM20 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The TOMM20 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TOMM20. This antibody reacts with human,mouse,rat. The TOMM20 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western.
target :
TOMM20
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEA
VQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQ
QLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDD
V
This antibody was developed against Recombinant Protein corresponding to amino acids:
VQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQ
QLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDD
V
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse,Rat
gene symbol :
TOMM20
Antibody validation :
Orthogonal Validation
applications :
IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western
USD :
569 USD
alt names :
KIAA0016Outer mitochondrial membrane receptor Tom20, MAS20, MGC117367, Mitochondrial 20 kDa outer membrane protein, mitochondrial import receptor subunit TOM20 homolog, MOM19, TOM20, translocase of outer mitochondrial membrane 20 homolog (yeast), translocase of outer mitochondrial membrane 20 homolog type II
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
related products
browse more products
questions and comments
