TOMM20 Antibody - BSA Free | Novus Biologicals NBP1-81556 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

TOMM20 Antibody - BSA Free

catalog :

NBP1-81556

quantity :

0.1 ml (also 25 ul)

price :

569 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

XVIF9-G10

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 22

Reference
Onuchic L, Padovano V, Schena G, Rajendran V, Dong K, Shi X, et al. The C-terminal tail of polycystin-1 suppresses cystic disease in a mitochondrial enzyme-dependent fashion. Nat Commun. 2023;14:1790 pubmed publisher
Guilhaume Correa F, Pickrell A, VandeVord P. The Imbalance of Astrocytic Mitochondrial Dynamics Following Blast-Induced Traumatic Brain Injury. Biomedicines. 2023;11: pubmed publisher
Urbano Gámez J, Casañas J, Benito I, Montesinos M. Prenatal treatment with rapamycin restores enhanced hippocampal mGluR-LTD and mushroom spine size in a Down's syndrome mouse model. Mol Brain. 2021;14:84 pubmed publisher
Ghosh P, Guo Y, Ashrafi A, Chen J, Dey S, Zhong S, et al. Oxygen-Enhanced Optoacoustic Tomography Reveals the Effectiveness of Targeting Heme and Oxidative Phosphorylation at Normalizing Tumor Vascular Oxygenation. Cancer Res. 2020;80:3542-3555 pubmed publisher
Li B, Zhao H, Wu Y, Zhu Y, Zhang J, Yang G, et al. Mitochondrial-Derived Vesicles Protect Cardiomyocytes Against Hypoxic Damage. Front Cell Dev Biol. 2020;8:214 pubmed publisher
Cassina L, Chiaravalli M, Boletta A. Increased mitochondrial fragmentation in polycystic kidney disease acts as a modifier of disease progression. FASEB J. 2020;34:6493-6507 pubmed publisher
Iannielli A, Ugolini G, Cordiglieri C, Bido S, Rubio A, Colasante G, et al. Reconstitution of the Human Nigro-striatal Pathway on-a-Chip Reveals OPA1-Dependent Mitochondrial Defects and Loss of Dopaminergic Synapses. Cell Rep. 2019;29:4646-4656.e4 pubmed publisher
Nordström C, Danckwardt Lillieström N, Liu W, Rask Andersen H. "Reversed polarization" of Na/K-ATPase-a sign of inverted transport in the human endolymphatic sac: a super-resolution structured illumination microscopy (SR-SIM) study. Cell Tissue Res. 2020;379:445-457 pubmed publisher
Liu W, Luque M, Glueckert R, Danckwardt Lillieström N, Nordström C, Schrott Fischer A, et al. Expression of Na/K-ATPase subunits in the human cochlea: a confocal and super-resolution microscopy study with special reference to auditory nerve excitation and cochlear implantation. Ups J Med Sci. 2019;124:168-179 pubmed publisher
Sala D, Cunningham T, Stec M, Etxaniz U, Nicoletti C, Dall Agnese A, et al. The Stat3-Fam3a axis promotes muscle stem cell myogenic lineage progression by inducing mitochondrial respiration. Nat Commun. 2019;10:1796 pubmed publisher
Ward J, Stoyas C, Switonski P, Ichou F, Fan W, Collins B, et al. Metabolic and Organelle Morphology Defects in Mice and Human Patients Define Spinocerebellar Ataxia Type 7 as a Mitochondrial Disease. Cell Rep. 2019;26:1189-1202.e6 pubmed publisher
Coleman L, Zou J, Crews F. Microglial-derived miRNA let-7 and HMGB1 contribute to ethanol-induced neurotoxicity via TLR7. J Neuroinflammation. 2017;14:22 pubmed publisher
Ivakine E, Acton B, Mahadevan V, Ormond J, Tang M, Pressey J, et al. Neto2 is a KCC2 interacting protein required for neuronal Cl- regulation in hippocampal neurons. Proc Natl Acad Sci U S A. 2013;110:3561-6 pubmed publisher
Rose E, Koo J, Antflick J, Ahmed S, Angers S, Hampson D. Glutamate transporter coupling to Na,K-ATPase. J Neurosci. 2009;29:8143-55 pubmed publisher
Hou Z, Matherly L. Oligomeric structure of the human reduced folate carrier: identification of homo-oligomers and dominant-negative effects on carrier expression and function. J Biol Chem. 2009;284:3285-93 pubmed publisher
Molday L, Wu W, Molday R. Retinoschisin (RS1), the protein encoded by the X-linked retinoschisis gene, is anchored to the surface of retinal photoreceptor and bipolar cells through its interactions with a Na/K ATPase-SARM1 complex. J Biol Chem. 2007;282:32792-801 pubmed
Ferguson S, Savchenko V, Apparsundaram S, Zwick M, Wright J, Heilman C, et al. Vesicular localization and activity-dependent trafficking of presynaptic choline transporters. J Neurosci. 2003;23:9697-709 pubmed
Hoffman J, Wickrema A, Potapova O, Milanick M, Yingst D. Na pump isoforms in human erythroid progenitor cells and mature erythrocytes. Proc Natl Acad Sci U S A. 2002;99:14572-7 pubmed
Brickley D, Mikosz C, Hagan C, Conzen S. Ubiquitin modification of serum and glucocorticoid-induced protein kinase-1 (SGK-1). J Biol Chem. 2002;277:43064-70 pubmed
Kong J, Meng J, Biser P, Fleming W, Taylor D. Cellular depolarization of neurons in the locus ceruleus region of the guinea pig associated with the development of tolerance to opioids. J Pharmacol Exp Ther. 2001;298:909-16 pubmed
Wetzel R, Sweadner K. Immunocytochemical localization of NaK-ATPase isoforms in the rat and mouse ocular ciliary epithelium. Invest Ophthalmol Vis Sci. 2001;42:763-9 pubmed
Tao Q, Hollenberg N, Graves S. Sodium pump inhibition and regional expression of sodium pump alpha-isoforms in lens. Hypertension. 1999;34:1168-74 pubmed

product information

master code :

NBP1-81556

SKU :

NBP1-81556

product name :

TOMM20 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The TOMM20 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TOMM20. This antibody reacts with human,mouse,rat. The TOMM20 Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western.

target :

TOMM20

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

KRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEA
VQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQ
QLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDD
V
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

TOMM20

Antibody validation :

Orthogonal Validation

applications :

IF/IHC,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Simple Western

USD :

569 USD

alt names :

KIAA0016Outer mitochondrial membrane receptor Tom20, MAS20, MGC117367, Mitochondrial 20 kDa outer membrane protein, mitochondrial import receptor subunit TOM20 homolog, MOM19, TOM20, translocase of outer mitochondrial membrane 20 homolog (yeast), translocase of outer mitochondrial membrane 20 homolog type II

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage