CEP164 Antibody - BSA Free | Novus Biologicals NBP1-81445 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

CEP164 Antibody - BSA Free

catalog :

NBP1-81445

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 14

Reference
Tsai Y, Kuo T, Lin R, Tsai H, Chao Y, Lee P, et al. MicroRNA‑155‑5p inhibits trophoblast cell proliferation and invasion by disrupting centrosomal function. Mol Med Rep. 2024;29: pubmed publisher
Lin R, Chao Y, Su M, Tsai H, Tsai P, Wang C. Upregulation of miR-20b-5p inhibits trophoblast invasion by blocking autophagy in recurrent miscarriage. Cell Signal. 2024;113:110934 pubmed publisher
Tsai Y, Kuo T, Chao Y, Lee P, Lin R, Xiao X, et al. PDGF-AA activates AKT and ERK signaling for testicular interstitial Leydig cell growth via primary cilia. J Cell Biochem. 2023;124:89-102 pubmed publisher
Chao Y, Huang B, Peng I, Lee P, Lai Y, Chiu W, et al. ATM- and ATR-induced primary ciliogenesis promotes cisplatin resistance in pancreatic ductal adenocarcinoma. J Cell Physiol. 2022;237:4487-4503 pubmed publisher
An H, Kuo H, Tang T. Modeling Human Primary Microcephaly With hiPSC-Derived Brain Organoids Carrying CPAP-E1235V Disease-Associated Mutant Protein. Front Cell Dev Biol. 2022;10:830432 pubmed publisher
Teng Y, Chang H, Chao Y, Cheng H, Lien W, Wang C. Etoposide Triggers Cellular Senescence by Inducing Multiple Centrosomes and Primary Cilia in Adrenocortical Tumor Cells. Cells. 2021;10: pubmed publisher
Conduit S, Davies E, Fulcher A, Oorschot V, Mitchell C. Superresolution Microscopy Reveals Distinct Phosphoinositide Subdomains Within the Cilia Transition Zone. Front Cell Dev Biol. 2021;9:634649 pubmed publisher
Chen T, Huang B, Tang T, Chao Y, Xiao X, Lee P, et al. Genotoxic stress-activated DNA-PK-p53 cascade and autophagy cooperatively induce ciliogenesis to maintain the DNA damage response. Cell Death Differ. 2021;: pubmed publisher
Chen T, Lin T, Kuo P, Chen Z, Cheng H, Chao Y, et al. Septin 7 is a centrosomal protein that ensures S phase entry and microtubule nucleation by maintaining the abundance of p150glued. J Cell Physiol. 2020;: pubmed publisher
Wang C, Su M, Cheng H, Kuo P, Tsai P. Fetuin-A Inhibits Placental Cell Growth and Ciliogenesis in Gestational Diabetes Mellitus. Int J Mol Sci. 2019;20: pubmed publisher
Colicino E, Stevens K, Curtis E, Rathbun L, Bates M, Manikas J, et al. Chromosome misalignment is associated with PLK1 activity at cenexin-positive mitotic centrosomes. Mol Biol Cell. 2019;:mbcE18120817 pubmed publisher
Tsai J, Hsu W, Liu J, Chang C, Tang T. CEP120 interacts with C2CD3 and Talpid3 and is required for centriole appendage assembly and ciliogenesis. Sci Rep. 2019;9:6037 pubmed publisher
Chen H, Wu C, Tang C, Lin Y, Wang W, Tang T. Human microcephaly protein RTTN interacts with STIL and is required to build full-length centrioles. Nat Commun. 2017;8:247 pubmed publisher
Karki M, Keyhaninejad N, Shuster C. Precocious centriole disengagement and centrosome fragmentation induced by mitotic delay. Nat Commun. 2017;8:15803 pubmed publisher

product information

master code :

NBP1-81445

SKU :

NBP1-81445

product name :

CEP164 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The CEP164 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to CEP164. This antibody reacts with human,mouse,zebrafish,fish - danio rerio (zebrafish). The CEP164 Antibody - BSA Free has been validated for the following applications: Immunocytochemistry/ Immunofluorescence,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

CEP164

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

DASQELEISEHMKEPQLSDSIASDPKSFHGLDFGFRSRI
SEHLLDVDVLSPVLGGACRQAQQPLGIEDKDDSQSSQDE
LQSKQSKGLEERLSPPLPHE
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Zebrafish,Fish - Danio rerio (Zebrafish)

gene symbol :

CEP164

accessionNumbers :

Q9UPV0

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

559 USD

alt names :

centrosomal protein 164kDa, FLJ54767

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage