product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
FUNDC1 Antibody - BSA Free
catalog :
NBP1-81063
quantity :
0.1 ml (also 25 ul)
price :
549 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
citations: 7
Reference
Kaur B, Miglioranza Scavuzzi B, Yang M, Yao J, Jia L, ABCOUWER S, et al. ER Stress and Mitochondrial Perturbations Regulate Cell Death in Retinal Detachment: Exploring the Role of HIF1α. Invest Ophthalmol Vis Sci. 2024;65:39 pubmed publisher
Jage x10d i x107 D, Petrovi x107 D, x160 imuni x107 I, Isakovi x107 J, Mitre x10d i x107 D. The Oxygen and Glucose Deprivation of Immature Cells of the Nervous System Exerts Distinct Effects on Mitochondria, Mitophagy, and Autophagy, Depending on the Cells' Differentiation Stage. Brain Sci. 2023;13: pubmed publisher
Madhu V, Hernandez Meadows M, Boneski P, Qiu Y, Guntur A, Kurland I, et al. The mitophagy receptor BNIP3 is critical for the regulation of metabolic homeostasis and mitochondrial function in the nucleus pulposus cells of the intervertebral disc. Autophagy. 2023;19:1821-1843 pubmed publisher
Wang C, Dai X, Wu S, Xu W, Song P, Huang K. FUNDC1-dependent mitochondria-associated endoplasmic reticulum membranes are involved in angiogenesis and neoangiogenesis. Nat Commun. 2021;12:2616 pubmed publisher
Livingston M, Wang J, Zhou J, Wu G, Ganley I, Hill J, et al. Clearance of damaged mitochondria via mitophagy is important to the protective effect of ischemic preconditioning in kidneys. Autophagy. 2019;:1-21 pubmed publisher
Wu S, Lu Q, Ding Y, Wu Y, Qiu Y, Wang P, et al. Hyperglycemia-Driven Inhibition of AMP-Activated Protein Kinase α2 Induces Diabetic Cardiomyopathy by Promoting Mitochondria-Associated Endoplasmic Reticulum Membranes In Vivo. Circulation. 2019;139:1913-1936 pubmed publisher
Singh B, Sinha R, Tripathi M, Mendoza A, Ohba K, Sy J, et al. Thyroid hormone receptor and ERR? coordinately regulate mitochondrial fission, mitophagy, biogenesis, and function. Sci Signal. 2018;11: pubmed publisher
product information
master code :
NBP1-81063
SKU :
NBP1-81063
product name :
FUNDC1 Antibody - BSA Free
unit size :
0.1 ml (also 25 ul)
description :
The FUNDC1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to FUNDC1. This antibody reacts with human,mouse. The FUNDC1 Antibody - BSA Free has been validated for the following applications: Immunoprecipitation,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin.
target :
FUNDC1
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGH
SSGPMVEKYSVATQIVM
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human,Mouse
gene symbol :
FUNDC1
accessionNumbers :
Q8IVP5
applications :
Immunoprecipitation,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin
USD :
549 USD
alt names :
FUN14 domain containing 1, FUN14 domain-containing protein 1, MGC51029
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.