FUNDC1 Antibody - BSA Free | Novus Biologicals NBP1-81063 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

FUNDC1 Antibody - BSA Free

catalog :

NBP1-81063

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Kaur B, Miglioranza Scavuzzi B, Yang M, Yao J, Jia L, ABCOUWER S, et al. ER Stress and Mitochondrial Perturbations Regulate Cell Death in Retinal Detachment: Exploring the Role of HIF1α. Invest Ophthalmol Vis Sci. 2024;65:39 pubmed publisher
Jage x10d i x107 D, Petrovi x107 D, x160 imuni x107 I, Isakovi x107 J, Mitre x10d i x107 D. The Oxygen and Glucose Deprivation of Immature Cells of the Nervous System Exerts Distinct Effects on Mitochondria, Mitophagy, and Autophagy, Depending on the Cells' Differentiation Stage. Brain Sci. 2023;13: pubmed publisher
Madhu V, Hernandez Meadows M, Boneski P, Qiu Y, Guntur A, Kurland I, et al. The mitophagy receptor BNIP3 is critical for the regulation of metabolic homeostasis and mitochondrial function in the nucleus pulposus cells of the intervertebral disc. Autophagy. 2023;19:1821-1843 pubmed publisher
Wang C, Dai X, Wu S, Xu W, Song P, Huang K. FUNDC1-dependent mitochondria-associated endoplasmic reticulum membranes are involved in angiogenesis and neoangiogenesis. Nat Commun. 2021;12:2616 pubmed publisher
Livingston M, Wang J, Zhou J, Wu G, Ganley I, Hill J, et al. Clearance of damaged mitochondria via mitophagy is important to the protective effect of ischemic preconditioning in kidneys. Autophagy. 2019;:1-21 pubmed publisher
Wu S, Lu Q, Ding Y, Wu Y, Qiu Y, Wang P, et al. Hyperglycemia-Driven Inhibition of AMP-Activated Protein Kinase α2 Induces Diabetic Cardiomyopathy by Promoting Mitochondria-Associated Endoplasmic Reticulum Membranes In Vivo. Circulation. 2019;139:1913-1936 pubmed publisher
Singh B, Sinha R, Tripathi M, Mendoza A, Ohba K, Sy J, et al. Thyroid hormone receptor and ERR? coordinately regulate mitochondrial fission, mitophagy, biogenesis, and function. Sci Signal. 2018;11: pubmed publisher

product information

master code :

NBP1-81063

SKU :

NBP1-81063

product name :

FUNDC1 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The FUNDC1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to FUNDC1. This antibody reacts with human,mouse. The FUNDC1 Antibody - BSA Free has been validated for the following applications: Immunoprecipitation,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

FUNDC1

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGH
SSGPMVEKYSVATQIVM
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse

gene symbol :

FUNDC1

accessionNumbers :

Q8IVP5

applications :

Immunoprecipitation,Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

549 USD

alt names :

FUN14 domain containing 1, FUN14 domain-containing protein 1, MGC51029

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage