MX2 Antibody - BSA Free | Novus Biologicals NBP1-81018 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

MX2 Antibody - BSA Free

catalog :

NBP1-81018

quantity :

0.1 ml (also 25 ul)

price :

549 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 14

Reference
Guo H, Yang W, Li H, Yang J, Huang Y, Tang Y, et al. The SAMHD1-MX2 axis restricts HIV-1 infection at postviral DNA synthesis. MBio. 2024;15:e0136324 pubmed publisher
Layish B, Goli R, Flick H, Huang S, Zhang R, Kvaratskhelia M, et al. Virus specificity and nucleoporin requirements for MX2 activity are affected by GTPase function and capsid-CypA interactions. bioRxiv. 2023;: pubmed publisher
Makokha G, Chayama K, Hayes C, Abe Chayama H, Abuduwaili M, Makoto H. Deficiency of SCAP inhibits HBV pathogenesis via activation of the interferon signaling pathway. Virology. 2023;585:248-258 pubmed publisher
Nasser H, Takahashi N, Eltalkhawy Y, Reda O, Lotfi S, Nasu K, et al. Inhibitory and Stimulatory Effects of IL-32 on HIV-1 Infection. J Immunol. 2022;209:970-978 pubmed publisher
Albanese M, Ruhle A, Mittermaier J, Mejías Pérez E, Gapp M, Linder A, et al. Rapid, efficient and activation-neutral gene editing of polyclonal primary human resting CD4+ T cells allows complex functional analyses. Nat Methods. 2022;19:81-89 pubmed publisher
Kurebayashi Y, Bajimaya S, Watanabe M, Lim N, Lutz M, Dunagan M, et al. Human parainfluenza virus type 1 regulates cholesterol biosynthesis and establishes quiescent infection in human airway cells. PLoS Pathog. 2021;17:e1009908 pubmed publisher
Betancor G, Jiménez Guardeño J, Lynham S, Antrobus R, Khan H, Sobala A, et al. MX2-mediated innate immunity against HIV-1 is regulated by serine phosphorylation. Nat Microbiol. 2021;6:1031-1042 pubmed publisher
Juraleviciute M, Nsengimana J, Newton Bishop J, Hendriks G, Slipicevic A. MX2 mediates establishment of interferon response profile, regulates XAF1, and can sensitize melanoma cells to targeted therapy. Cancer Med. 2021;10:2840-2854 pubmed publisher
Arwert E, Milford E, Rullan A, Derzsi S, Hooper S, Kato T, et al. STING and IRF3 in stromal fibroblasts enable sensing of genomic stress in cancer cells to undermine oncolytic viral therapy. Nat Cell Biol. 2020;22:758-766 pubmed publisher
Choi J, Zhang T, Vu A, Ablain J, Makowski M, Colli L, et al. Massively parallel reporter assays of melanoma risk variants identify MX2 as a gene promoting melanoma. Nat Commun. 2020;11:2718 pubmed publisher
Cao H, Krueger E, Chen J, Drizyte Miller K, Schulz M, McNiven M. The anti-viral dynamin family member MxB participates in mitochondrial integrity. Nat Commun. 2020;11:1048 pubmed publisher
Yi D, An N, Liu Z, Xu F, Raniga K, Li Q, et al. Human MxB Inhibits the Replication of Hepatitis C Virus. J Virol. 2019;93: pubmed publisher
Martínez López A, Martín Fernandez M, Buta S, Kim B, Bogunovic D, Diaz Griffero F. SAMHD1 deficient human monocytes autonomously trigger type I interferon. Mol Immunol. 2018;101:450-460 pubmed publisher
Kane M, Rebensburg S, Takata M, Zang T, Yamashita M, Kvaratskhelia M, et al. Nuclear pore heterogeneity influences HIV-1 infection and the antiviral activity of MX2. elife. 2018;7: pubmed publisher

product information

master code :

NBP1-81018

SKU :

NBP1-81018

product name :

MX2 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The MX2 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to MX2. This antibody reacts with human. The MX2 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

MX2

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPP
NWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human

theoretical molecular weight :

82 kDa

gene symbol :

MX2

accessionNumbers :

P20592

applications :

Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

549 USD

alt names :

human interferon-regulated resistance GTP-binding protein MXB10Interferon-regulated resistance GTP-binding protein MxB, interferon-induced GTP-binding protein Mx2, MXB, myxovirus (influenza virus) resistance 2 (mouse), myxovirus (influenza) resistance 2, homolog of murine, Myxovirus resistance protein 2, p78-related protein, second interferon-induced protein p78

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage