This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
KCTD3 Antibody
catalog :
NBP1-80981
quantity :
0.1 ml (also 25 ul)
price :
529 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus
master code :
NBP1-80981
SKU :
NBP1-80981
product name :
KCTD3 Antibody
unit size :
0.1 ml (also 25 ul)
seo description :
The KCTD3 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to KCTD3. This antibody reacts with human. The KCTD3 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.
target :
KCTD3
category :
Primary Antibodies
buffer :
PBS (pH 7.2) and 40% Glycerol
clonality :
Polyclonal
conjugate :
Unconjugated
dilution :
Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
host :
Rabbit
immunogen :
ITPLVRRLLLCEELERSSCGSVLFHGYLPPPGIPSRKIN
NTVRSADSRNGLNSTEGEARGNGTQPVLSGTGEETVRLG
FPVDPRKVLIVAGHHNWIVAAYAHFAVCYRIKESSGWQQ
VFTSP
This antibody was developed against Recombinant Protein corresponding to amino acids:
NTVRSADSRNGLNSTEGEARGNGTQPVLSGTGEETVRLG
FPVDPRKVLIVAGHHNWIVAAYAHFAVCYRIKESSGWQQ
VFTSP
This antibody was developed against Recombinant Protein corresponding to amino acids:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
gene symbol :
KCTD3
accessionNumbers :
Q9Y597
applications :
Immunohistochemistry,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence
USD :
529 USD
alt names :
BTB/POZ domain-containing protein KCTD3, potassium channel tetramerisation domain containing 3, renal carcinoma antigen NY-REN-45
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
