TSG101 Antibody - BSA Free | Novus Biologicals NBP1-80659 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

TSG101 Antibody - BSA Free

catalog :

NBP1-80659

quantity :

0.1 ml (also 25 ul)

price :

559 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 9

Reference
Jiao W, Hao J, Liu J, Gao W, Zhao J, Li Y. Mesenchymal stem cells-derived extracellular vesicle-incorporated H19 attenuates cardiac remodeling in rats with heart failure. Kaohsiung J Med Sci. 2024;40:46-62 pubmed publisher
Kim E, Kim J, Kim S, Hong N, Choi S, Park M, et al. The oncogenic JAG1 intracellular domain is a transcriptional cofactor that acts in concert with DDX17/SMAD3/TGIF2. Cell Rep. 2022;41:111626 pubmed publisher
Hua Y, Dai C, He Q, Cai X, Li M. Autoantibody panel on small extracellular vesicles for the early detection of lung cancer. Clin Immunol. 2022;245:109175 pubmed publisher
Carotenuto P, Romano A, Barbato A, Quadrano P, Brillante S, Volpe M, et al. Targeting the MITF/APAF-1 axis as salvage therapy for MAPK inhibitors in resistant melanoma. Cell Rep. 2022;41:111601 pubmed publisher
Pauwels M, Xie J, Ceroi A, Balusu S, Castelein J, Van Wonterghem E, et al. Choroid plexus-derived extracellular vesicles exhibit brain targeting characteristics. Biomaterials. 2022;290:121830 pubmed publisher
Majewska A, Brodaczewska K, Filipiak Duliban A, Kajdasz A, Kieda C. miRNA Pattern in Hypoxic Microenvironment of Kidney Cancer-Role of PTEN. Biomolecules. 2022;12: pubmed publisher
Vandendriessche C, Balusu S, Van Cauwenberghe C, Brkic M, Pauwels M, Plehiers N, et al. Importance of extracellular vesicle secretion at the blood-cerebrospinal fluid interface in the pathogenesis of Alzheimer's disease. Acta Neuropathol Commun. 2021;9:143 pubmed publisher
Zar xe0 M, Campodonico J, Cosentino N, Biondi M, Amadio P, Milanesi G, et al. Plasma Exosome Profile in ST-Elevation Myocardial Infarction Patients with and without Out-of-Hospital Cardiac Arrest. Int J Mol Sci. 2021;22: pubmed publisher
Millan C, Prause L, Vallmajo Martin Q, Hensky N, Eberli D. Extracellular Vesicles from 3D Engineered Microtissues Harbor Disease-Related Cargo Absent in EVs from 2D Cultures. Adv Healthc Mater. 2021;:e2002067 pubmed publisher

product information

master code :

NBP1-80659

SKU :

NBP1-80659

product name :

TSG101 Antibody - BSA Free

unit size :

0.1 ml (also 25 ul)

description :

The TSG101 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TSG101. This antibody reacts with human,mouse,rat. The TSG101 Antibody - BSA Free has been validated for the following applications: Western Blot,Simple Western,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockdown Validated.

target :

TSG101

category :

Primary Antibodies

buffer :

PBS (pH 7.2) and 40% Glycerol

clonality :

Polyclonal

conjugate :

Unconjugated

host :

Rabbit

immunogen :

RMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQ
EVAEVDKNIELLKKKDEELSSALEKMENQSENNDIDEVI
IPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLD
VFLKHVRLLS
This antibody was developed against Recombinant Protein corresponding to amino acids:

isotype :

IgG

purity :

Immunogen affinity purified

species :

Human,Mouse,Rat

gene symbol :

TSG101

Antibody validation :

Knockout/Knockdown

accessionNumbers :

Q99816

applications :

Western Blot,Simple Western,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry,Immunohistochemistry-Paraffin,Knockdown Validated

USD :

559 USD

alt names :

ESCRT-I complex subunit TSG101, TSG10, tumor susceptibility gene 10, tumor susceptibility gene 101, tumor susceptibility gene 101 protein, tumor susceptibility protein, VPS23

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage