G6PC Antibody - BSA Free | Novus Biologicals NBP1-80533 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

G6PC Antibody - BSA Free

catalog :

NBP1-80533

quantity :

100 ul

price :

469 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Lin H, Lin C, Kuo Y, Shih C. Antidiabetic and Antihyperlipidemic Activities and Molecular Mechanisms of Phyllanthus emblica L. Extract in Mice on a High-Fat Diet. Curr Issues Mol Biol. 2024;46:10492-10529 pubmed publisher
Nishi K, Yoshii A, Abell L, Zhou B, Frausto R, Ritterhoff J, et al. Branched-chain keto acids inhibit mitochondrial pyruvate carrier and suppress gluconeogenesis in hepatocytes. Cell Rep. 2023;42:112641 pubmed publisher
Yu X, Meng Z, Fang T, Liu X, Cheng Y, Xu L, et al. Empagliflozin Inhibits Hepatic Gluconeogenesis and Increases Glycogen Synthesis by AMPK/CREB/GSK3β Signalling Pathway. Front Physiol. 2022;13:817542 pubmed publisher
Bhat N, Narayanan A, Fathzadeh M, Kahn M, Zhang D, Goedeke L, et al. Dyrk1b promotes hepatic lipogenesis by bypassing canonical insulin signaling and directly activating mTORC2 in mice. J Clin Invest. 2022;132: pubmed publisher
Pang H, Li J, Wang Y, Su X, Gao Y, Li S. Mice lacking the proton channel Hv1 exhibit sex-specific differences in glucose homeostasis. J Biol Chem. 2021;297:101212 pubmed publisher
Ji Y, Wang Y, Li P, Cai L, Wang X, Bai L, et al. A kinome screen reveals that Nemo-like kinase is a key suppressor of hepatic gluconeogenesis. Cell Metab. 2021;33:1171-1186.e9 pubmed publisher
Chen S, Henderson A, Petriello M, Romano K, Gearing M, Miao J, et al. Trimethylamine N-Oxide Binds and Activates PERK to Promote Metabolic Dysfunction. Cell Metab. 2019;30:1141-1151.e5 pubmed publisher

product information

master code :

NBP1-80533

SKU :

NBP1-80533

product name :

G6PC Antibody - BSA Free

unit size :

100 ul

description :

The G6PC Antibody - BSA Free from Novus is a rabbit polyclonal antibody to G6PC. This antibody reacts with human,mouse. The G6PC Antibody - BSA Free has been validated for the following applications: Western Blot.

target :

G6PC

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFP
IWFHLKETVGI.
Synthetic peptide corresponding to aa 10-59 in the N-terminal region of mouse G6PC (NP_032087). Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse

theoretical molecular weight :

40 kDa

gene symbol :

G6PC1

accessionNumbers :

P35576

applications :

Western Blot

USD :

469 USD

alt names :

EC 3.1.3.9, G6Pase, G-6-Pase, G6Pase-alpha, G6PT, glucose-6-phosphatase, Glucose-6-phosphatase alpha, glucose-6-phosphatase, catalytic (glycogen storage disease type I, von Gierkedisease), glucose-6-phosphatase, catalytic subunit, GSD1, GSD1a, MGC163350

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage