This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Advillin Antibody
catalog :
NBP1-80312
quantity :
100 ul
price :
329 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot, immunocytochemistry
citations: 1
product information
SKU :
NBP1-80312
product name :
Advillin Antibody
unit size :
100 ul
Description :
The Advillin Antibody from Novus is a rabbit polyclonal antibody to Advillin. This antibody reacts with human, mouse, rat, porcine, bovine, canine, equine, guinea pig, rabbit. The Advillin Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence.
target :
Advillin
category :
Primary Antibodies
buffer :
PBS 2% Sucrose.
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
QELPEDVNPAKKENYLSEQDFVSVFGITRGQFAALPGWK
QLQMKKEKGLF
Synthetic peptide directed towards the middle region of human AVIL. Peptide sequence:
QLQMKKEKGLF
Synthetic peptide directed towards the middle region of human AVIL. Peptide sequence:
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
theoretical molecular weight :
92 kDa
gene symbol :
AVIL
catalog number base :
NBP1-80312
accessionNumbers :
NP_006567
applications :
Western Blot, Immunocytochemistry/Immunofluorescence
2020 Proposedprice USD :
329 USD
alt names :
ADVIL, advillin, DOC6, FLJ12386, MGC133244, p92DKFZp779O1812
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
