TGF-beta 1 Antibody - BSA Free | Novus Biologicals NBP1-80289 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

TGF-beta 1 Antibody - BSA Free

catalog :

NBP1-80289

quantity :

100 ul (also 20 ul)

price :

459 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 8

Reference
Xu M, Tan J, Zhu L, Ge C, Zhang Y, Gao F, et al. Palmitoyltransferase ZDHHC3 Aggravates Nonalcoholic Steatohepatitis by Targeting S-Palmitoylated IRHOM2. Adv Sci (Weinh). 2023;10:e2302130 pubmed publisher
Medipally A, Xiao M, Satoskar A, Biederman L, Dasgupta A, Ivanov I, et al. N-acetylcysteine ameliorates hematuria-associated tubulointerstitial injury in 5/6 nephrectomy mice. Physiol Rep. 2023;11:e15767 pubmed publisher
Ma C, Wang L, Liao W, Liu Y, Mishra S, Li G, et al. TGF-β promotes stem-like T cells via enforcing their lymphoid tissue retention. J Exp Med. 2022;219: pubmed publisher
Yao G, Mo X, Yin C, Lou W, Wang Q, Huang S, et al. A programmable and skin temperature-activated electromechanical synergistic dressing for effective wound healing. Sci Adv. 2022;8:eabl8379 pubmed publisher
Nordquist E, Dutta P, Kodigepalli K, Mattern C, McDermott M, Trask A, et al. Tgfβ1-Cthrc1 Signaling Plays an Important Role in the Short-Term Reparative Response to Heart Valve Endothelial Injury. Arterioscler Thromb Vasc Biol. 2021;41:2923-2942 pubmed publisher
Yang J, Ku S, Cho I, Lee J, Na C, Ki S. Neoagarooligosaccharide Protects against Hepatic Fibrosis via Inhibition of TGF-β/Smad Signaling Pathway. Int J Mol Sci. 2021;22: pubmed publisher
Bashir A. Cathepsin L in unstable plaques. Arch Med Sci Atheroscler Dis. 2020;5:e57-e63 pubmed publisher
Chung S, Overstreet J, Li Y, Wang Y, Niu A, Wang S, et al. TGF-β promotes fibrosis after severe acute kidney injury by enhancing renal macrophage infiltration. JCI Insight. 2018;3: pubmed publisher

product information

master code :

NBP1-80289

SKU :

NBP1-80289

product name :

TGF-beta 1 Antibody - BSA Free

unit size :

100 ul (also 20 ul)

description :

The TGF-beta 1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to TGF-beta 1. This antibody reacts with human,mouse,porcine,rat. The TGF-beta 1 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,IF/IHC,Immunohistochemistry-Paraffin,Imaging Mass Cytometry.

target :

TGF-beta 1

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKD
NKLHVEINGIS.
Synthetic peptide directed towards the middle region of mouse TGFB1. Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse,Porcine,Rat

theoretical molecular weight :

43 kDa

gene symbol :

TGFB1

accessionNumbers :

NP_035707

applications :

Immunohistochemistry,Immunocytochemistry/ Immunofluorescence,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Imaging Mass Cytometry

USD :

459 USD

alt names :

CEDLAP, DPD1, latency-associated peptide, TGF beta, TGFB, TGFbeta, TGF-beta 1 protein, TGF-beta-1, transforming growth factor beta-1, transforming growth factor, beta 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage