Snail Antibody - BSA Free | Novus Biologicals NBP1-80022 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Snail Antibody - BSA Free

catalog :

NBP1-80022

quantity :

100 ul

price :

489 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 13

Reference
Han J, Kim Y, Kim H, Lee J, Oh M, Kim S, et al. Snail acetylation by autophagy-derived acetyl-coenzyme A promotes invasion and metastasis of KRAS-LKB1 co-mutated lung cancer cells. Cancer Commun (Lond). 2022;42:716-749 pubmed publisher
Rodriguez Tirado C, Kale N, Carlini M, Shrivastava N, Rodrigues A, Khalil B, et al. NR2F1 Is a Barrier to Dissemination of Early-Stage Breast Cancer Cells. Cancer Res. 2022;82:2313-2326 pubmed publisher
Belulescu I, M x103 rg x103 ritescu C, Dumitrescu C, Munteanu M, D x103 guci L, M x103 rg x103 ritescu O, et al. The immunophenotype of epithelial to mesenchymal transition inducing transcription factors in salivary gland adenoid cystic carcinomas. Rom J Morphol Embryol. 2020;61:769-782 pubmed publisher
Sad x142 ecki P, J xf3 x17a wicki J, Antosik P, Walentowicz Sad x142 ecka M. Expression of Selected Epithelial-Mesenchymal Transition Transcription Factors in Endometrial Cancer. Biomed Res Int. 2020;2020:4584250 pubmed publisher
Park J, Hah Y, Ryu S, Cheon S, Cho H, Kim J, et al. Periostin Plays a Key Role in Radioresistance of Head and Neck Cancer Cells Via Epithelial-to-Mesenchymal Transition. Anticancer Res. 2020;40:2627-2635 pubmed publisher
Hah Y, Cho H, Jo S, Park Y, Heo E, Yoon T. Nicotinamide N‑methyltransferase induces the proliferation and invasion of squamous cell carcinoma cells. Oncol Rep. 2019;42:1805-1814 pubmed publisher
Taparra K, Wang H, Malek R, Lafargue A, Barbhuiya M, Wang X, et al. O-GlcNAcylation is required for mutant KRAS-induced lung tumorigenesis. J Clin Invest. 2018;128:4924-4937 pubmed publisher
Marioni G, Cappellesso R, Ottaviano G, Fasanaro E, Marchese Ragona R, Favaretto N, et al. Nuclear nonmetastatic protein 23-H1 expression and epithelial-mesenchymal transition in laryngeal carcinoma: A pilot investigation. Head Neck. 2018;40:2020-2028 pubmed publisher
Sadlecki P, Jóźwicki J, Antosik P, Grabiec M. Expression of selected epithelial-mesenchymal transition transcription factors in serous borderline ovarian tumors and type I ovarian cancers. Tumour Biol. 2018;40:1010428318784807 pubmed publisher
Gershon E, Hadas R, Elbaz M, Booker E, Muchnik M, Kleinjan Elazary A, et al. Identification of Trophectoderm-Derived Cripto as an Essential Mediator of Embryo Implantation. Endocrinology. 2018;159:1793-1807 pubmed publisher
Yang G, Zhao Z, Zhang X, Wu A, Huang Y, Miao Y, et al. Effect of berberine on the renal tubular epithelial-to-mesenchymal transition by inhibition of the Notch/snail pathway in diabetic nephropathy model KKAy mice. Drug Des Devel Ther. 2017;11:1065-1079 pubmed publisher
Sakamuri S, Takawale A, Basu R, Fedak P, Freed D, Sergi C, et al. Differential impact of mechanical unloading on structural and nonstructural components of the extracellular matrix in advanced human heart failure. Transl Res. 2016;172:30-44 pubmed publisher
Shirakawa T, Miyahara Y, Tanimura K, Morita H, Kawakami F, Itoh T, et al. Expression of Epithelial-Mesenchymal Transition-related Factors in Adherent Placenta. Int J Gynecol Pathol. 2015;34:584-9 pubmed publisher

product information

master code :

NBP1-80022

SKU :

NBP1-80022

product name :

Snail Antibody - BSA Free

unit size :

100 ul

description :

The Snail Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Snail. This antibody reacts with human,mouse. The Snail Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence.

target :

Snail

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAH
LLAAIPPPEIL.
Synthetic peptide directed towards the N terminal of human SNAI1. Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse

theoretical molecular weight :

29 kDa

gene symbol :

SNAI1

accessionNumbers :

NP_005976

applications :

Immunohistochemistry,IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunocytochemistry/ Immunofluorescence

USD :

489 USD

alt names :

dJ710H13.1, Protein sna, Protein snail homolog 1, SLUGH2, SNA, SNAH, SNAI1, SNAIL, snail 1 homolog, snail 1 zinc finger protein, snail family zinc finger 1, snail homolog 1, SNAIL1, zinc finger protein SNAI1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage