This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ZFHX2 Antibody
catalog :
NBP1-79998
quantity :
100 ul (also 20 ul)
price :
329 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
SKU :
NBP1-79998
product name :
ZFHX2 Antibody
unit size :
100 ul (also 20 ul)
Description :
The ZFHX2 Antibody from Novus is a rabbit polyclonal antibody to ZFHX2. This antibody reacts with human, mouse, rat, bovine, canine, equine, guinea pig, rabbit. The ZFHX2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
target :
ZFHX2
category :
Primary Antibodies
buffer :
PBS 2% Sucrose.
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
GGQGSPPEASLPPSAGDKEPKTKSSWQCKVCSYETNISR
NLRIHMTSEKH.
Synthetic peptide directed towards the middle region of human ZNF409. Peptide sequence
NLRIHMTSEKH.
Synthetic peptide directed towards the middle region of human ZNF409. Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
theoretical molecular weight :
92 kDa
gene symbol :
ZFHX2
catalog number base :
NBP1-79998
accessionNumbers :
XP_375065
applications :
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
2020 Proposedprice USD :
329 USD
alt names :
KIAA1762, MGC141820, zinc finger homeobox 2, zinc finger homeodomain protein 2, zinc finger protein 409
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
