This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SPDEF Antibody
catalog :
NBP1-74237
quantity :
100 ul (also 20 ul)
price :
329 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot
product information
SKU :
NBP1-74237
product name :
SPDEF Antibody
unit size :
100 ul (also 20 ul)
Description :
The SPDEF Antibody from Novus is a rabbit polyclonal antibody to SPDEF. This antibody reacts with human, mouse, rat, bovine, canine, equine, guinea pig, rabbit, zebrafish. The SPDEF Antibody has been validated for the following applications: Western Blot.
target :
SPDEF
category :
Primary Antibodies
buffer :
PBS 2% Sucrose.
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
FKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGI
IRKPDISQRLV.
Synthetic peptides corresponding to the C terminal of SPDEF. Immunizing peptide sequence
IRKPDISQRLV.
Synthetic peptides corresponding to the C terminal of SPDEF. Immunizing peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
theoretical molecular weight :
37 kDa
gene symbol :
SPDEF
catalog number base :
NBP1-74237
accessionNumbers :
O95238
applications :
Western Blot
2020 Proposedprice USD :
329 USD
alt names :
bA375E1.3, PDEFRP11-375E1__A.3, Prostate epithelium-specific Ets transcription factor, Prostate-derived Ets factor, Prostate-specific Ets, PSE, SAM pointed domain containing ets transcription factor, SAM pointed domain-containing Ets transcription factor
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
