This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Steroid sulfatase Antibody
catalog :
NBP1-69686
quantity :
100 ul
price :
329 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, dogs, bovine, zebrafish
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
SKU :
NBP1-69686
product name :
Steroid sulfatase Antibody
unit size :
100 ul
Description :
The Steroid sulfatase Antibody from Novus is a rabbit polyclonal antibody to Steroid sulfatase. This antibody reacts with human, mouse, porcine, bovine, canine, equine, guinea pig, rabbit, zebrafish. The Steroid sulfatase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
target :
Steroid sulfatase
category :
Primary Antibodies
buffer :
PBS 2% Sucrose.
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKS
QRSDHEFLFHY.
Synthetic peptides corresponding to STS(steroid sulfatase (microsomal), isozyme S) The peptide sequence was selected from the middle region of STS. Peptide sequence
QRSDHEFLFHY.
Synthetic peptides corresponding to STS(steroid sulfatase (microsomal), isozyme S) The peptide sequence was selected from the middle region of STS. Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Mouse, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
theoretical molecular weight :
63 kDa
gene symbol :
STS
catalog number base :
NBP1-69686
accessionNumbers :
P08842
applications :
Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
2020 Proposedprice USD :
329 USD
alt names :
ARSC1ES, ARSCsteroid sulfatase (microsomal), arylsulfatase C, isozyme S, Arylsulfatase C, ASC, EC 3.1.6, EC 3.1.6.2, estrone sulfatase, SSDD, Steroid sulfatase, steroid sulfatase (microsomal), isozyme S, steryl-sulfatase, Steryl-sulfate sulfohydrolase, XLI
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
