This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SRD5A3 Antibody
catalog :
NBP1-69612
quantity :
100 ul (also 20 ul)
price :
349 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
citations: 1
product information
brand :
Novus
master code :
NBP1-69612
SKU :
NBP1-69612
product name :
SRD5A3 Antibody
description :
The SRD5A3 Antibody from NBP1-69612 is a nbp1-69612 antibody to . The SRD5A3 Antibody has been validated for the following applications: Q9H8P0.
target :
SRD5A3
category :
Primary Antibodies
unit sizes :
100 ul (also 20 ul)
buffer :
PBS and 2% Sucrose
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYF
SHFYIISVLWN.
Synthetic peptides corresponding to SRD5A3(steroid 5 alpha-reductase 3) The peptide sequence was selected from the N terminal of SRD5A3. Peptide sequence
GLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYF
SHFYIISVLWN.
Synthetic peptides corresponding to SRD5A3(steroid 5 alpha-reductase 3) The peptide sequence was selected from the N terminal of SRD5A3. Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Rat
theoretical molecular weight :
36 kDa
gene symbol :
SRD5A3
accessionNumbers :
Q9H8P0
applications :
Western Blot
USD :
349 USD
alt names :
3-oxo-5-alpha-steroid 4-dehydrogenase 3, CDG1P, EC 1.3.1.-, EC 1.3.99.5, FLJ13352, probable polyprenol reductase, S5AR 3, SR type 3, SRD5A2L1, SRD5A2LCDG1Q, steroid 5 alpha-reductase 3, Steroid 5-alpha-reductase 2-like, Steroid 5-alpha-reductase 3
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
