PMEL17/SILV Antibody - BSA Free | Novus Biologicals NBP1-69571 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

PMEL17/SILV Antibody - BSA Free

catalog :

NBP1-69571

quantity :

100 ul

price :

399 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

HI30

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Reference
Ruotsalainen J, Lopez Ramos D, Rogava M, Shridhar N, Glodde N, Gaffal E, et al. The myeloid cell type I IFN system promotes antitumor immunity over pro-tumoral inflammation in cancer T-cell therapy. Clin Transl Immunology. 2021;10:e1276 pubmed publisher
Braun A, Mengoni M, Bonifatius S, Tüting T, Gaffal E. Activated Hgf-Met Signaling Cooperates with Oncogenic BRAF to Drive Primary Cutaneous Melanomas and Angiotropic Lung Metastases in Mice. J Invest Dermatol. 2020;140:1410-1417.e2 pubmed publisher
Po J, Ma Y, Balakrishna B, Brungs D, Azimi F, De Souza P, et al. Immunomagnetic isolation of circulating melanoma cells and detection of PD-L1 status. PLoS ONE. 2019;14:e0211866 pubmed publisher
Forsthuber A, Lipp K, Andersen L, Ebersberger S, Graña Castro O, Ellmeier W, et al. CXCL5 as Regulator of Neutrophil Function in Cutaneous Melanoma. J Invest Dermatol. 2019;139:186-194 pubmed publisher
Kallergi G, Vetsika E, Aggouraki D, Lagoudaki E, Koutsopoulos A, Koinis F, et al. Evaluation of PD-L1/PD-1 on circulating tumor cells in patients with advanced non-small cell lung cancer. Ther Adv Med Oncol. 2018;10:1758834017750121 pubmed publisher
Riesenberg S, Groetchen A, Siddaway R, Bald T, Reinhardt J, Smorra D, et al. MITF and c-Jun antagonism interconnects melanoma dedifferentiation with pro-inflammatory cytokine responsiveness and myeloid cell recruitment. Nat Commun. 2015;6:8755 pubmed publisher
HÃ¶lzel M, Landsberg J, Glodde N, Bald T, Rogava M, Riesenberg S, et al. A Preclinical Model of Malignant Peripheral Nerve Sheath Tumor-like Melanoma Is Characterized by Infiltrating Mast Cells. Cancer Res. 2016;76:251-63 pubmed publisher

product information

master code :

NBP1-69571

SKU :

NBP1-69571

product name :

PMEL17/SILV Antibody - BSA Free

unit size :

100 ul

description :

The PMEL17/SILV Antibody - BSA Free from Novus is a rabbit polyclonal antibody to PMEL17/SILV. This antibody reacts with human,mouse. The PMEL17/SILV Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Immunoprecipitation.

target :

PMEL17/SILV

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

1 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTL
ISRALVVTHTY.
Synthetic peptides corresponding to SILV(silver homolog (mouse)) The peptide sequence was selected from the N terminal of human PMEL (NP_008859). Peptide sequence

isotype :

IgG

purity :

Protein A purified

species :

Human,Mouse

theoretical molecular weight :

70 kDa

gene symbol :

PMEL

accessionNumbers :

P40967

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry,Immunoprecipitation

USD :

399 USD

alt names :

D12S53EP1, gp100, ME20, ME20-M, melanocyte protein mel 17, Melanocyte protein Pmel 17, Melanocytes lineage-specific antigen GP100, Melanoma-associated ME20 antigen, melanosomal matrix protein17, PMEL17P100, premelanosome proteinME20M, SI, SIL, silver (mouse homolog) like, silver homolog (mouse), Silver locus protein homolog, silver, mouse, homolog of, SILVPmel17

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage