product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
PMEL17/SILV Antibody - BSA Free
catalog :
NBP1-69571
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
HI30
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation, immunohistochemistry - paraffin section
more info or order :
citations: 7
Reference
Ruotsalainen J, Lopez Ramos D, Rogava M, Shridhar N, Glodde N, Gaffal E, et al. The myeloid cell type I IFN system promotes antitumor immunity over pro-tumoral inflammation in cancer T-cell therapy. Clin Transl Immunology. 2021;10:e1276 pubmed publisher
Braun A, Mengoni M, Bonifatius S, Tüting T, Gaffal E. Activated Hgf-Met Signaling Cooperates with Oncogenic BRAF to Drive Primary Cutaneous Melanomas and Angiotropic Lung Metastases in Mice. J Invest Dermatol. 2020;140:1410-1417.e2 pubmed publisher
Po J, Ma Y, Balakrishna B, Brungs D, Azimi F, De Souza P, et al. Immunomagnetic isolation of circulating melanoma cells and detection of PD-L1 status. PLoS ONE. 2019;14:e0211866 pubmed publisher
Forsthuber A, Lipp K, Andersen L, Ebersberger S, Graña Castro O, Ellmeier W, et al. CXCL5 as Regulator of Neutrophil Function in Cutaneous Melanoma. J Invest Dermatol. 2019;139:186-194 pubmed publisher
Kallergi G, Vetsika E, Aggouraki D, Lagoudaki E, Koutsopoulos A, Koinis F, et al. Evaluation of PD-L1/PD-1 on circulating tumor cells in patients with advanced non-small cell lung cancer. Ther Adv Med Oncol. 2018;10:1758834017750121 pubmed publisher
Riesenberg S, Groetchen A, Siddaway R, Bald T, Reinhardt J, Smorra D, et al. MITF and c-Jun antagonism interconnects melanoma dedifferentiation with pro-inflammatory cytokine responsiveness and myeloid cell recruitment. Nat Commun. 2015;6:8755 pubmed publisher
Hölzel M, Landsberg J, Glodde N, Bald T, Rogava M, Riesenberg S, et al. A Preclinical Model of Malignant Peripheral Nerve Sheath Tumor-like Melanoma Is Characterized by Infiltrating Mast Cells. Cancer Res. 2016;76:251-63 pubmed publisher
product information
brand :
Novus
catalog number base :
NBP1-69571
SKU :
NBP1-69571
product name :
PMEL17/SILV Antibody - BSA Free
units size :
100 ul
description :
The PMEL17/SILV Antibody - BSA Free from Novus is a rabbit polyclonal antibody to PMEL17/SILV. This antibody reacts with human,mouse. The PMEL17/SILV Antibody - BSA Free has been validated for the following applications: IF/IHC,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin.
target :
PMEL17/SILV
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
1 mg/ml
conjugate :
Unconjugated
all_available conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTL
ISRALVVTHTY.
Synthetic peptides corresponding to SILV(silver homolog (mouse)) The peptide sequence was selected from the N terminal of human PMEL (NP_008859). Peptide sequence
isotype :
IgG
purity :
Protein A purified
species :
Human,Mouse
theoretical molecular weight :
70 kDa
gene symbol :
PMEL
top caption :
Western Blot: PMEL17/SILV Antibody [NBP1-69571]
accessionNumbers :
P40967
applications :
IF/IHC,Immunohistochemistry,Immunoprecipitation,Western Blot,Immunohistochemistry-Paraffin
USD :
399 USD
alt names :
D12S53EP1, gp100, ME20, ME20-M, melanocyte protein mel 17, Melanocyte protein Pmel 17, Melanocytes lineage-specific antigen GP100, Melanoma-associated ME20 antigen, melanosomal matrix protein17, PMEL17P100, premelanosome proteinME20M, SI, SIL, silver (mouse homolog) like, silver homolog (mouse), Silver locus protein homolog, silver, mouse, homolog of, SILVPmel17
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information
Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com
3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.