This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
NETO2 Antibody
catalog :
NBP1-62591
quantity :
100 ul (also 20 ul)
price :
329 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot, immunohistochemistry, immunocytochemistry
product information
SKU :
NBP1-62591
product name :
NETO2 Antibody
unit size :
100 ul (also 20 ul)
Description :
The NETO2 Antibody from Novus is a rabbit polyclonal antibody to NETO2. This antibody reacts with human, mouse, rat, bovine, canine, equine, guinea pig, rabbit. The NETO2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.
target :
NETO2
category :
Primary Antibodies
buffer :
PBS and 2% Sucrose
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
ELSGADGIVRSSQVEQEEKTKPGQAVDCIWTIKATPKAK
IYLRFLDYQME.
Synthetic peptides corresponding to NETO2(neuropilin (NRP) and tolloid (TLL)-like 2) The peptide sequence was selected from the N terminal of NETO2. Peptide sequence
IYLRFLDYQME.
Synthetic peptides corresponding to NETO2(neuropilin (NRP) and tolloid (TLL)-like 2) The peptide sequence was selected from the N terminal of NETO2. Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
theoretical molecular weight :
57 kDa
gene symbol :
NETO2
catalog number base :
NBP1-62591
accessionNumbers :
Q8NC67
applications :
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
2020 Proposedprice USD :
329 USD
alt names :
Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor classA domains protein 2, BTCL2, FLJ10430, FLJ90456, NEOT2FLJ14724, neuropilin (NRP) and tolloid (TLL)-like 2, neuropilin and tolloid-like protein 2
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
