This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Cytochrome P450 1A1 Antibody
catalog :
NBP1-62405
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-62405
SKU :
NBP1-62405
product name :
Cytochrome P450 1A1 Antibody
description :
The Cytochrome P450 1A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cytochrome P450 1A1. This antibody reacts with human,mouse. The Cytochrome P450 1A1 Antibody has been validated for the following applications: Western Blot.
target :
Cytochrome P450 1A1
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRV
QRKIQEELDTV.
Synthetic peptides corresponding to CYP1A1(cytochrome P450, family 1, subfamily A, polypeptide 1) The peptide sequence was selected from the middle region of CYP1A1 (NP_000490). Peptide sequence
QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRV
QRKIQEELDTV.
Synthetic peptides corresponding to CYP1A1(cytochrome P450, family 1, subfamily A, polypeptide 1) The peptide sequence was selected from the middle region of CYP1A1 (NP_000490). Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
58 kDa
gene symbol :
CYP1A1
accessionNumbers :
P04798
applications :
Western Blot
USD :
399
USD 2025 :
399 USD
alt names :
AHH, AHRR, aryl hydrocarbon hydroxylase, CP11, CYP1, CYPIA1, cytochrome P1-450, dioxin-inducible, cytochrome P450 1A1, Cytochrome P450 form 6, cytochrome P450, family 1, subfamily A, polypeptide 1, Cytochrome P450-C, Cytochrome P450-P1, EC 1.14.14.1, flavoprotein-linked monooxygenase, P1-450, P450-C, P450DX, subfamily I (aromatic compound-inducible), polypeptide 1, xenobiotic monooxygenase
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
