This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MCTP1 Antibody
catalog :
NBP1-59908
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-59908
SKU :
NBP1-59908
product name :
MCTP1 Antibody
description :
The MCTP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCTP1. This antibody reacts with human. The MCTP1 Antibody has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
MCTP1
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNK
QLTGPTKGVIY.
Synthetic peptides corresponding to MCTP1(multiple C2 domains, transmembrane 1) The peptide sequence was selected from the middle region of MCTP1. Peptide sequence
EVTVYDEDRDRSADFLGKVAIPLLSIQNGEQKAYVLKNK
QLTGPTKGVIY.
Synthetic peptides corresponding to MCTP1(multiple C2 domains, transmembrane 1) The peptide sequence was selected from the middle region of MCTP1. Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
gene symbol :
MCTP1
accessionNumbers :
Q6DN14-2
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
399
USD 2025 :
399 USD
alt names :
FLJ22344, multiple C2 and transmembrane domain-containing protein 1, multiple C2 domains, transmembrane 1, multiple C2-domains with two transmembrane regions 1
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
