This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
ORP8 Antibody
catalog :
NBP1-59815
quantity :
100 ul
price :
329 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot
product information
SKU :
NBP1-59815
product name :
ORP8 Antibody
unit size :
100 ul
Description :
The ORP8 Antibody from Novus is a rabbit polyclonal antibody to ORP8. This antibody reacts with human, mouse, rat, bovine, canine, equine, guinea pig, rabbit. The ORP8 Antibody has been validated for the following applications: Western Blot.
target :
ORP8
category :
Primary Antibodies
buffer :
PBS and 2% Sucrose
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
YSSPEPDIQDSSGSEAQSVKPSTRRKKGIELGDIQSSIE
SIKQTQEEIKR.
Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the middle region of OSBPL8. Peptide sequence
SIKQTQEEIKR.
Synthetic peptides corresponding to OSBPL8(oxysterol binding protein-like 8) The peptide sequence was selected from the middle region of OSBPL8. Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
theoretical molecular weight :
97 kDa
gene symbol :
OSBPL8
catalog number base :
NBP1-59815
accessionNumbers :
Q68D75
applications :
Western Blot
2020 Proposedprice USD :
329 USD
alt names :
MGC126578, MGC133203, MST120, MSTP120, ORP-8, ORP8KIAA1451, OSBP10DKFZp686A11164, OSBP-related protein 8, oxysterol binding protein-like 8, oxysterol-binding protein-related protein 8
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
