ATP6V0C Antibody - BSA Free | Novus Biologicals NBP1-59654 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

ATP6V0C Antibody - BSA Free

catalog :

NBP1-59654

quantity :

100 ul

price :

459 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

JM59-11

reactivity :

human, mouse

application :

western blot

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Meng D, Yang Q, Jeong M, Curukovic A, Tiwary S, Melick C, et al. SNAT7 regulates mTORC1 via macropinocytosis. Proc Natl Acad Sci U S A. 2022;119:e2123261119 pubmed publisher
Ma T, Tian X, Zhang B, Li M, Wang Y, Yang C, et al. Low-dose metformin targets the lysosomal AMPK pathway through PEN2. Nature. 2022;603:159-165 pubmed publisher
Weber R, Yen F, Nicholson S, Alwaseem H, Bayraktar E, Alam M, et al. Maintaining Iron Homeostasis Is the Key Role of Lysosomal Acidity for Cell Proliferation. Mol Cell. 2020;77:645-655.e7 pubmed publisher
Li M, Zhang C, Zong Y, Feng J, Ma T, Hu M, et al. Transient Receptor Potential V Channels Are Essential for Glucose Sensing by Aldolase and AMPK. Cell Metab. 2019;: pubmed publisher
Merk H, Messer P, Ardelt M, Lamb D, Zahler S, Muller R, et al. Inhibition of the V-ATPase by Archazolid A: A New Strategy to Inhibit EMT. Mol Cancer Ther. 2017;16:2329-2339 pubmed publisher
Zhang C, Li M, Ma T, Zong Y, Cui J, Feng J, et al. Metformin Activates AMPK through the Lysosomal Pathway. Cell Metab. 2016;24:521-522 pubmed publisher

product information

master code :

NBP1-59654

SKU :

NBP1-59654

product name :

ATP6V0C Antibody - BSA Free

unit size :

100 ul

description :

The ATP6V0C Antibody - BSA Free from Novus is a rabbit polyclonal antibody to ATP6V0C. This antibody reacts with human,mouse. The ATP6V0C Antibody - BSA Free has been validated for the following applications: Western Blot.

target :

ATP6V0C

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFA
IGIVGDAGVRG.
Synthetic peptide directed towards the middle region of human ATP6V0C (NP_001685). Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse

theoretical molecular weight :

16 kDa

gene symbol :

ATP6V0C

accessionNumbers :

P27449

applications :

Western Blot

USD :

459 USD

alt names :

ATP6CATPase, H+ transporting, lysosomal (vacuolar proton pump) 16kD, ATP6LVPPC, ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c, ATPL, H(+)-transporting two-sector ATPase, 16 kDa subunit, vacuolar ATP synthase 16 kDa proteolipid subunit, vacuolar H+ ATPase proton channel subunit, Vacuolar proton pump 16 kDa proteolipid subunit, VATL, V-ATPase 16 kDa proteolipid subunit, Vma3, V-type proton ATPase 16 kDa proteolipid subunit

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage