This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SPTLC1 Antibody
catalog :
NBP1-59643
quantity :
100 ul
price :
409 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-59643
SKU :
NBP1-59643
product name :
SPTLC1 Antibody
description :
The SPTLC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SPTLC1. This antibody reacts with human. The SPTLC1 Antibody has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
SPTLC1
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEH
YGINIDDIDLI.
Synthetic peptides corresponding to SPTLC1(serine palmitoyltransferase, long chain base subunit 1) The peptide sequence was selected from the middle region of SPTLC1. Peptide sequence
ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEH
YGINIDDIDLI.
Synthetic peptides corresponding to SPTLC1(serine palmitoyltransferase, long chain base subunit 1) The peptide sequence was selected from the middle region of SPTLC1. Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
53 kDa
gene symbol :
SPTLC1
accessionNumbers :
O15269
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
399
USD 2025 :
409 USD
alt names :
EC 2.3.1.50, hereditary sensory neuropathy, type 1, HSAN1, LBC1, LCB 1, LCB1HSAN, Long chain base biosynthesis protein 1, MGC14645, serine C-palmitoyltransferase, serine palmitoyltransferase 1, serine palmitoyltransferase, long chain base subunit 1, Serine-palmitoyl-CoA transferase 1, SPT 1, SPT1HSN1, SPTI
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
