EAAT2/GLT1 Antibody - BSA Free | Novus Biologicals NBP1-59632 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

EAAT2/GLT1 Antibody - BSA Free

catalog :

NBP1-59632

quantity :

100 ul

price :

459 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

ESEE122

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 6

Published Application/Species/Sample/Dilution	Reference
western blot; human; 1:1000; fig 5b	Singal C, Jaiswal P, Mehta A, Saleem K, Seth P. Role of EphrinA3 in HIV-1 Neuropathogenesis. ASN Neuro. 2021;13:17590914211044359 pubmed publisher
	Herrera Moro Chao D, Kirchner M, Pham C, Foppen E, Denis R, Castel J, et al. Hypothalamic astrocytes control systemic glucose metabolism and energy balance. Cell Metab. 2022;34:1532-1547.e6 pubmed publisher
	R x1ce dulescu A, Todd G, Williams C, Bennink B, Lemus A, Chesbro H, et al. Estimating the glutamate transporter surface density in distinct sub-cellular compartments of mouse hippocampal astrocytes. PLoS Comput Biol. 2022;18:e1009845 pubmed publisher
	Song K, Kim J, Lee Y, Bae H, Lee H, Woo S, et al. Mitochondrial reprogramming via ATP5H loss promotes multimodal cancer therapy resistance. J Clin Invest. 2018;128:4098-4114 pubmed publisher
	Pallottie A, Ratnayake A, Ni L, Acioglu C, Li L, Mirabelli E, et al. A toll-like receptor 9 antagonist restores below-level glial glutamate transporter expression in the dorsal horn following spinal cord injury. Sci Rep. 2018;8:8723 pubmed publisher
	García Berrocoso T, Llombart V, Colàs Campàs L, Hainard A, Licker V, Penalba A, et al. Single Cell Immuno-Laser Microdissection Coupled to Label-Free Proteomics to Reveal the Proteotypes of Human Brain Cells After Ischemia. Mol Cell Proteomics. 2018;17:175-189 pubmed publisher

product information

master code :

NBP1-59632

SKU :

NBP1-59632

product name :

EAAT2/GLT1 Antibody - BSA Free

unit size :

100 ul

description :

The EAAT2/GLT1 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to EAAT2/GLT1. This antibody reacts with human,mouse. The EAAT2/GLT1 Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry.

target :

EAAT2/GLT1

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
PGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQ
ACFQQIQTVTK
Synthetic peptides corresponding to SLC1A2(solute carrier family 1 (glial high affinity glutamate transporter), member 2) The peptide sequence was selected from the N terminal of SLC1A2 (NP_004162).

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse

theoretical molecular weight :

62 kDa

gene symbol :

SLC1A2

accessionNumbers :

P43004

applications :

Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry

USD :

459 USD

alt names :

GLT1, member 2, solute carrier family 1 (glial high affinity glutamate transporter), member 2, Solute carrier family 1 member 2

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage