Wnt-7b Antibody - BSA Free | Novus Biologicals NBP1-59564 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Wnt-7b Antibody - BSA Free

catalog :

NBP1-59564

quantity :

100 ul

price :

459 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

SPM568

reactivity :

human, mouse

application :

western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Novus Biologicals product webpage

citations: 6

Reference
Yu T, Zhou F, Tian W, Xu R, Wang B, Zeng A, et al. EZH2 interacts with HP1BP3 to epigenetically activate WNT7B that promotes temozolomide resistance in glioblastoma. Oncogene. 2023;42:461-470 pubmed publisher
Degirmenci B, Dincer C, Demirel H, Berkova L, Moor A, Kahraman A, et al. Epithelial Wnt secretion drives the progression of inflammation-induced colon carcinoma in murine model. iScience. 2021;24:103369 pubmed publisher
Hill M, Alexander W, Guo B, Kato Y, Patra K, O Dell M, et al. Kras and Tp53 Mutations Cause Cholangiocyte- and Hepatocyte-Derived Cholangiocarcinoma. Cancer Res. 2018;78:4445-4451 pubmed publisher
Liu J, Wu X, Zhang H, Qiu R, Yoshikawa K, Lu Q. Prospective separation and transcriptome analyses of cortical projection neurons and interneurons based on lineage tracing by Tbr2 (Eomes)-GFP/Dcx-mRFP reporters. Dev Neurobiol. 2016;76:587-99 pubmed publisher
Miyake M, Yamashiro K, Tabara Y, Suda K, Morooka S, Nakanishi H, et al. Identification of myopia-associated WNT7B polymorphisms provides insights into the mechanism underlying the development of myopia. Nat Commun. 2015;6:6689 pubmed publisher
Suo L, Sundberg J, Everts H. Dietary vitamin A regulates wingless-related MMTV integration site signaling to alter the hair cycle. Exp Biol Med (Maywood). 2015;240:618-23 pubmed publisher

product information

master code :

NBP1-59564

SKU :

NBP1-59564

product name :

Wnt-7b Antibody - BSA Free

unit size :

100 ul

description :

The Wnt-7b Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Wnt-7b. This antibody reacts with human,mouse. The Wnt-7b Antibody - BSA Free has been validated for the following applications: IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry.

target :

Wnt-7b

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLR
IKQLRSYQKPM.
Synthetic peptides corresponding to WNT7B(wingless-type MMTV integration site family, member 7B) The peptide sequence was selected from the middle region of WNT7B (NP_478679) Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Human,Mouse

theoretical molecular weight :

36 kDa

gene symbol :

WNT7B

accessionNumbers :

P56706

applications :

IF/IHC,Western Blot,Immunohistochemistry-Paraffin,Immunohistochemistry-Frozen,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry

USD :

459 USD

alt names :

protein Wnt-7b, wingless-type MMTV integration site family, member 7B

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage