This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
SLC25A28 Antibody
catalog :
NBP1-59562
quantity :
100 ul
price :
409 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-59562
SKU :
NBP1-59562
product name :
SLC25A28 Antibody
description :
The SLC25A28 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC25A28. This antibody reacts with human,mouse. The SLC25A28 Antibody has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
SLC25A28
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGV
QARVIYQIPST.
Synthetic peptides corresponding to SLC25A28(solute carrier family 25, member 28) The peptide sequence was selected from the C terminal of SLC25A28. Peptide sequence
NTQESLALNSHITGHITGMASAFRTVYQVGGVTAYFRGV
QARVIYQIPST.
Synthetic peptides corresponding to SLC25A28(solute carrier family 25, member 28) The peptide sequence was selected from the C terminal of SLC25A28. Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
gene symbol :
SLC25A28
accessionNumbers :
Q96A46
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
399
USD 2025 :
409 USD
alt names :
DKFZp547C109, hMRS3/4, MFRN2, Mitochondrial iron transporter 2, Mitochondrial RNA-splicing protein 3/4 homolog, mitoferrin-2, MRS3/4MRS4Lmitochondrial RNA splicing protein 3/4, NPD016, putative mitochondrial solute carrier, Solute carrier family 25 member 28, solute carrier family 25, member 28
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
