This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Indian Hedgehog/Ihh Antibody
catalog :
NBP1-59443
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunohistochemistry - paraffin section
citations: 1
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-59443
SKU :
NBP1-59443
product name :
Indian Hedgehog/Ihh Antibody
description :
The Indian Hedgehog/Ihh Antibody from Novus Biologicals is a rabbit polyclonal antibody to Indian Hedgehog/Ihh. This antibody reacts with human,mouse. The Indian Hedgehog/Ihh Antibody has been validated for the following applications: Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin.
target :
Indian Hedgehog/Ihh
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
1 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLG
ASGRYEGKIAR.
Synthetic peptides corresponding to IHH(Indian hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of IHH. Peptide sequence
AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLG
ASGRYEGKIAR.
Synthetic peptides corresponding to IHH(Indian hedgehog homolog (Drosophila)) The peptide sequence was selected from the N terminal of IHH. Peptide sequence
isotype :
IgG
purity :
Protein A purified
species :
Human,Mouse
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
45 kDa
gene symbol :
IHH
accessionNumbers :
Q14623
applications :
Immunohistochemistry,Western Blot,Immunohistochemistry-Paraffin
USD :
399
USD 2025 :
399 USD
alt names :
BDA1Indian hedgehog homolog (Drosophila), HHG2, HHG-2, Indian hedgehog, Indian hedgehog (Drosophila) homolog, Indian hedgehog homolog, indian hedgehog protein
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
