product summary
Loading...
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Tetraspanin-4 Antibody - BSA Free
catalog :
NBP1-59438
quantity :
100 ul
price :
419 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot, immunohistochemistry, immunocytochemistry, immunohistochemistry - paraffin section
more info or order :
citations: 1
image
image 1 :

Western Blot: Tetraspanin-4 Antibody [NBP1-59438]
product information
master code :
NBP1-59438
SKU :
NBP1-59438
product name :
Tetraspanin-4 Antibody - BSA Free
unit size :
100 ul
description :
The Tetraspanin-4 Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Tetraspanin-4. This antibody reacts with human,rat. The Tetraspanin-4 Antibody - BSA Free has been validated for the following applications: Immunohistochemistry,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Paraffin.
target :
Tetraspanin-4
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
(NP_001020405). The peptide sequence for this immunogen was taken from within the described region.
YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDF
RCCGVSNYTDW
Synthetic peptides corresponding to TSPAN4 (tetraspanin 4) The peptide sequence was selected from the middle region of TSPAN4) Peptide sequence
YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDF
RCCGVSNYTDW
Synthetic peptides corresponding to TSPAN4 (tetraspanin 4) The peptide sequence was selected from the middle region of TSPAN4) Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human,Rat
theoretical molecular weight :
26 kDa
gene symbol :
TSPAN4
accessionNumbers :
O14817
applications :
Immunohistochemistry,Western Blot,Immunocytochemistry/ Immunofluorescence,Immunohistochemistry-Paraffin
USD :
419 USD
alt names :
Novel antigen 2, TETRASPAN, tetraspanin 4, tetraspanin-4, Transmembrane 4 superfamily member 7NAG-2NAG2TM4SF7tetraspan TM4SF, TSPAN-4
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
more info or order :
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
