This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
CLN6 Antibody
catalog :
NBP1-59415
quantity :
100 ul
price :
379 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot, immunohistochemistry, immunocytochemistry
product information
SKU :
NBP1-59415
product name :
CLN6 Antibody
unit size :
100 ul
Description :
The CLN6 Antibody from Novus is a rabbit polyclonal antibody to CLN6. This antibody reacts with human, mouse, rat, porcine, bovine, canine, equine, guinea pig, rabbit, sheep, zebrafish. The CLN6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence.
target :
CLN6
category :
Primary Antibodies
buffer :
PBS and 2% Sucrose
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKY
PGVIYVPEPWA.
Synthetic peptides corresponding to CLN6(ceroid-lipofuscinosis, neuronal 6, late infantile, variant) The peptide sequence was selected from the C terminal of CLN6 (NP_060352). Peptide sequence
PGVIYVPEPWA.
Synthetic peptides corresponding to CLN6(ceroid-lipofuscinosis, neuronal 6, late infantile, variant) The peptide sequence was selected from the C terminal of CLN6 (NP_060352). Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
theoretical molecular weight :
36 kDa
gene symbol :
CLN6
catalog number base :
NBP1-59415
accessionNumbers :
Q9NWW5
applications :
Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
2020 Proposedprice USD :
379 USD
alt names :
ceroid-lipofuscinosis neuronal protein 6, ceroid-lipofuscinosis, neuronal 6, late infantile, variant, FLJ20561, HsT18960, nclf, Protein CLN6
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
