This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
LCLAT1 Antibody
catalog :
NBP1-59347
quantity :
100 ul
price :
399 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-59347
SKU :
NBP1-59347
product name :
LCLAT1 Antibody
description :
The LCLAT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to LCLAT1. This antibody reacts with human. The LCLAT1 Antibody has been validated for the following applications: Western Blot.
target :
LCLAT1
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLH
KQPHLNSKKNE.
Synthetic peptides corresponding to LYCAT(lysocardiolipin acyltransferase) The peptide sequence was selected from the middle region of human LYCAT. Peptide sequence
YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLH
KQPHLNSKKNE.
Synthetic peptides corresponding to LYCAT(lysocardiolipin acyltransferase) The peptide sequence was selected from the middle region of human LYCAT. Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
44 kDa
gene symbol :
LCLAT1
accessionNumbers :
B4DYR5
applications :
Western Blot
USD :
399
USD 2025 :
399 USD
alt names :
1-acylglycerol-3-phosphate O-acyltransferase 8, 1-AGPAT 8, Acyl-CoA:lysocardiolipin acyltransferase 1, AGPAT8lysocardiolipin acyltransferase, ALCAT11AGPAT8, EC 2.3.1.-, EC 2.3.1.51, FLJ37965, HSRG1849, LYCAT, lysocardiolipin acyltransferase 1, UNQ1849,1-AGP acyltransferase 8
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
