Hepcidin Antimicrobial Peptide Antibody - BSA Free | Novus Biologicals NBP1-59337 product information

product summary

company name :

Novus Biologicals

other brands :

IMGENEX

product type :

antibody

product name :

Hepcidin Antimicrobial Peptide Antibody - BSA Free

catalog :

NBP1-59337

quantity :

100 ul

price :

399 USD

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, bovine

application :

western blot, immunohistochemistry, immunohistochemistry - paraffin section

more info or order :

Novus Biologicals product webpage

citations: 7

Published Application/Species/Sample/Dilution	Reference
western blot; human; 1:500; loading ...; fig 1c	Ashok A, Chaudhary S, Wise A, Rana N, McDonald D, Kritikos A, et al. Release of Iron-Loaded Ferritin in Sodium Iodate-Induced Model of Age Related Macular Degeneration: An In-Vitro and In-Vivo Study. Antioxidants (Basel). 2021;10: pubmed publisher
	Koo J, Seong C, Parker R, Herrera A, Dwivedi B, Arthur R, et al. Live-Cell Invasive Phenotyping Uncovers ALK2 as a Therapeutic Target in LKB1-Mutant Lung Cancer. Cancer Res. 2024;84:3761-3771 pubmed publisher
	Koo J, Seong C, Parker R, Dwivedi B, Arthur R, Dinasarapu A, et al. Live-cell invasive phenotyping uncovers the ALK2/BMP6 iron homeostasis pathway as a therapeutic vulnerability in LKB1-mutant lung cancer. bioRxiv. 2023;: pubmed publisher
	Chaudhary S, Ashok A, Wise A, Rana N, McDonald D, Kritikos A, et al. Upregulation of brain hepcidin in prion diseases. Prion. 2021;15:126-137 pubmed publisher
	Ashok A, Chaudhary S, Kritikos A, Kang M, McDonald D, Rhee D, et al. TGFβ2-Hepcidin Feed-Forward Loop in the Trabecular Meshwork Implicates Iron in Glaucomatous Pathology. Invest Ophthalmol Vis Sci. 2020;61:24 pubmed publisher
	Ashok A, Chaudhary S, McDonald D, Kritikos A, Bhargava D, Singh N. Local synthesis of hepcidin in the anterior segment of the eye: A novel observation with physiological and pathological implications. Exp Eye Res. 2020;190:107890 pubmed publisher
	Bose C, Megyesi J, Shah S, Hiatt K, Hall K, Karaduta O, et al. Evidence Suggesting a Role of Iron in a Mouse Model of Nephrogenic Systemic Fibrosis. PLoS ONE. 2015;10:e0136563 pubmed publisher

product information

master code :

NBP1-59337

SKU :

NBP1-59337

product name :

Hepcidin Antimicrobial Peptide Antibody - BSA Free

unit size :

100 ul

description :

The Hepcidin Antimicrobial Peptide Antibody - BSA Free from Novus is a rabbit polyclonal antibody to Hepcidin Antimicrobial Peptide. This antibody reacts with bovine,human,mouse. The Hepcidin Antimicrobial Peptide Antibody - BSA Free has been validated for the following applications: Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin.

target :

Hepcidin Antimicrobial Peptide

category :

Primary Antibodies

buffer :

PBS, 2% Sucrose

clonality :

Polyclonal

concentration :

0.5 mg/ml

conjugate :

Unconjugated

host :

Rabbit

immunogen :

The peptide sequence for this immunogen was taken from within the described region.
MALSSQIWAACLLLLLLLASLTSGSVFPQQTGQLAELQP
QDRAGARASWM.
Synthetic peptides corresponding to HAMP(hepcidin antimicrobial peptide) The peptide sequence was selected from the N terminal of HAMP. Peptide sequence

isotype :

IgG

purity :

Affinity purified

species :

Bovine,Human,Mouse

theoretical molecular weight :

9 kDa

gene symbol :

HAMP

accessionNumbers :

P81172

applications :

Western Blot,Immunohistochemistry,Immunohistochemistry-Paraffin

USD :

399 USD

alt names :

hepcidin antimicrobial peptide, HEPCPutative liver tumor regressor, HFE2Bhepcidin, LEAP-1, LEAP1PLTR, Liver-expressed antimicrobial peptide 1

storage :

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

more info or order :

Novus Biologicals product webpage