This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
Slit3 Antibody
catalog :
NBP1-59140
quantity :
100 ul (also 20 ul)
price :
349 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
citations: 1
product information
brand :
Novus
master code :
NBP1-59140
SKU :
NBP1-59140
product name :
Slit3 Antibody
description :
The Slit3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Slit3. This antibody reacts with human. The Slit3 Antibody has been validated for the following applications: Western Blot.
target :
Slit3
category :
Primary Antibodies
unit size :
100 ul (also 20 ul)
buffer :
PBS and 2% Sucrose
clonality :
Polyclonal
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVC
PEKCRCEGTIV.
Synthetic peptides corresponding to SLIT3(slit homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of SLIT3 (NP_003053). Peptide sequence
PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVC
PEKCRCEGTIV.
Synthetic peptides corresponding to SLIT3(slit homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of SLIT3 (NP_003053). Peptide sequence
isotype :
IgG
purity :
Immunogen affinity purified
species :
Human
theoretical molecular weight :
168 kDa
gene symbol :
SLIT3
catalog number base :
NBP1-59140
accessionNumbers :
O75094
applications :
Western Blot
USD 2021 :
329
USD 2022 :
349 USD
atl names :
KIAA0814, MEGF5Multiple epidermal growth factor-like domains protein 5, Multiple EGF-like domains protein 5, SLIL2, SLIL2FLJ10764, slit homolog 3 (Drosophila), slit homolog 3 protein, SLIT1, slit2, Slit-3slit (Drosophila) homolog 3
storage :
Store at -20C. Avoid freeze-thaw cycles.
company information

Novus Biologicals
8100 Southpark Way, A-8
Littleton, CO 80120
Littleton, CO 80120
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
