This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Novus Biologicals
other brands :
IMGENEX
product type :
antibody
product name :
MUL1 Antibody
catalog :
NBP1-59068
quantity :
100 ul
price :
409 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot
product information
brand :
Novus Biologicals, a Bio-Techne brand
catalog number base :
NBP1-59068
SKU :
NBP1-59068
product name :
MUL1 Antibody
description :
The MUL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MUL1. This antibody reacts with human,mouse. The MUL1 Antibody has been validated for the following applications: Western Blot.
target :
MUL1
unit size :
100 ul
category :
Primary Antibodies
buffer :
PBS, 2% Sucrose
clonality :
Polyclonal
concentration :
0.5 mg/ml
conjugate :
Unconjugated
host :
Rabbit
immunogen :
The peptide sequence for this immunogen was taken from within the described region.
GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCAT
LFFILRKQYLQ.
Synthetic peptides corresponding to C1ORF166 The peptide sequence was selected from the middle region of C1ORF166 (NP_078820). Peptide sequence
GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCAT
LFFILRKQYLQ.
Synthetic peptides corresponding to C1ORF166 The peptide sequence was selected from the middle region of C1ORF166 (NP_078820). Peptide sequence
isotype :
IgG
purity :
Affinity purified
species :
Human,Mouse
storage :
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
theoretical molecular weight :
40 kDa
gene symbol :
MUL1
applications :
Western Blot
USD :
399
USD 2025 :
409 USD
alt names :
C1orf166mitochondrial E3 ubiquitin ligase 1, E3 ubiquitin-protein ligase MUL1, EC 6.3.2, EC 6.3.2.-, FLJ12875, GIDERP11-401M16.2, Growth inhibition and death E3 ligase, MAPLE3 ubiquitin ligase, mitochondrial E3 ubiquitin protein ligase 1, mitochondrial ubiquitin ligase activator of NF-kB, mitochondrial ubiquitin ligase activator of NFKB 1, Mitochondrial-anchored protein ligase, MULANchromosome 1 open reading frame 166, Putative NF-kappa-B-activating protein 266, RING finger protein 218, RNF218mitochondria-anchored protein ligase
company information

Novus Biologicals
10771 E Easter Ave
Centennial, CO 80112
Centennial, CO 80112
novus@novusbio.com
https://www.novusbio.com3037301950
headquarters: USA
Novus Biologicals licenses, manufactures, and markets antibodies to over 20,000 unique targets to support a wide array of research areas. Novus is built on honesty, collaboration and strong relationships and continues to provide quality tools that accelerate research. Every product is backed by our 100% guarantee.
questions and comments
